KEGG   Felis catus (domestic cat): 101100621
Entry
101100621         CDS       T02385                                 
Name
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha isoform X1
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    101100621
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101100621
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    101100621
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101100621
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    101100621
   04090 CD molecules [BR:fca04090]
    101100621
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL3 receptor family
   101100621
CD molecules [BR:fca04090]
 Proteins
  101100621
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind fn3 EpoR_lig-bind
Other DBs
NCBI-GeneID: 101100621
NCBI-ProteinID: XP_019679058
LinkDB
Position
X:975880..994473
AA seq 451 aa
MSSLGTVGILGQEPHNVTNHPVKRATLPWVPCPPPLGLPRPPSRPLGPLATTILFCMLLD
PALPLTQEHQDVPTTEWVPSLNMKFDRRTMELSWDCKENTTYLECVMIHKEKGEIRKKPK
NKDCHCNFSHDSLHGGVTFVVKVNSTQGPIPEKLVYANPGGEGTAAQNFSCFIYNVNFMN
CTWAKGRAAPDDVQYFLYIQDFKEKRERECPHYVTDSGTHVGCHLHDLSGLTFRNYFLVN
GTSRETAVQFFDTILSLKKIEIYSPPNNVSVDCNPSHCQILWDPPRTRHPSSAWDFNYQL
RIQKQNNKEHAGNQLIDVTGKSENKYNFPSPEPRPKHTVTIRASDARGQHWSAWSQPVEF
GSTQATASFVHIYVLVVLGTFVCALILSCLVKRLFASETLFPRIPHIKDKWSENVHTDHQ
IIWEKSTPDTGKIDHEEILTVEEVTVAPESV
NT seq 1356 nt   +upstreamnt  +downstreamnt
atgtcctccttggggactgtcggcatcctcggccaagagccgcacaacgtgactaaccat
ccagtcaaaagagcaaccctcccgtgggtcccctgcccgccacccttggggcttcctcgt
cctcccagccgccccctgggacccttggccacaaccatcctgttctgtatgctgctggac
ccagcgttacccctgactcaggagcaccaggatgttccaaccacggaatgggtccccagt
ctaaatatgaagtttgaccgaaggacaatggaactgagttgggactgcaaagaaaacact
acctacctcgaatgtgtgatgatccacaaggagaaaggagagatcagaaaaaagcccaag
aacaaagactgtcactgcaacttttcccatgattctctccatgggggagtcacgttcgtg
gttaaagtaaatagcacccaaggaccgattccagaaaaactggtctacgctaacccaggt
ggcgagggcaccgctgcccaaaacttctcctgttttatctacaacgtgaacttcatgaac
tgcacttgggcgaaaggtcgggctgcgcctgatgacgtccaatatttcttgtacatacaa
gactttaaggaaaaaagggaaagagagtgtcctcattacgtgacggactcaggaacccac
gtcggatgtcacctgcacgatctgtcgggactaacgttccgcaattacttcctggtgaac
ggtaccagccgagagacagcggtccagttttttgatacgattttgtccttgaaaaaaata
gaaatatacagcccgcccaacaacgtcagcgtcgactgcaacccgtcccactgccagatc
ctctgggacccgcccaggacgcgacacccctcgtccgcctgggacttcaactaccagctg
cgcatccagaaacagaacaacaaggaacacgccggaaatcaactgatcgatgtgaccggc
aaatcggaaaataaatacaacttcccgagtccagagcccagacccaagcacactgtgaca
atacgggcctcggacgcacggggacagcattggagcgcctggagccagcccgtggagttt
ggctccacacaagccacagccagctttgtgcacatctatgtgctcgtggtcctggggacc
ttcgtctgtgccctgattctcagctgccttgtgaaaaggttgtttgcatcagagacctta
ttcccgcggattccgcacatcaaggataaatggagtgagaacgttcacactgaccaccag
atcatctgggagaaatccaccccggatacaggaaagatcgaccatgaagaaatcctaacc
gtggaggaagtcaccgtcgccccggagagcgtgtga

KEGG   Felis catus (domestic cat): 102901718
Entry
102901718         CDS       T02385                                 
Name
(RefSeq) granulocyte-macrophage colony-stimulating factor receptor subunit alpha-like
  KO
K05066  granulocyte-macrophage colony-stimulating factor receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04630  JAK-STAT signaling pathway
fca04640  Hematopoietic cell lineage
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 JAK-STAT signaling pathway
    102901718
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    102901718
 09150 Organismal Systems
  09151 Immune system
   04640 Hematopoietic cell lineage
    102901718
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    102901718
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:fca04050]
    102901718
   04090 CD molecules [BR:fca04090]
    102901718
Cytokine receptors [BR:fca04050]
 Interleukin receptor families
  IL3 receptor family
   102901718
CD molecules [BR:fca04090]
 Proteins
  102901718
SSDB
Motif
Pfam: IL3Ra_N IL6Ra-bind
Other DBs
NCBI-GeneID: 102901718
NCBI-ProteinID: XP_019679061
LinkDB
Position
X:1000391..1023639
AA seq 410 aa
MVAVLDLVTFLVVLKSACCAQPRPAQDKISPIINMQLDSRKKMLTWTYTRNVSHQECTID
TPTAYSATVNPQVTEDHTYVCTFPNSVLHRGANLTVNVTCDGDVFLQVLTFANPGREGSG
AVNFSCLIYNVRLMNCSWAPGPAAPADVKYRLFWASRHEADAECVHYILGPTGTRVGCHF
DQLGKPQRTDNYFFLVNGTSRETAIPFLDFTPFKAVQIEKYNPPRNITITYNRSHHIIRW
EHPEIRFDLSSHMLYYELHIQTPASSAETNRVFQRGQDPNVYLMPSSATRAKSAFRVRVR
YMYNRLWSEWSPTQRFGLPEQDFSGALVGPVVGTAALSALVLKFLCKRFSVRRKMFPPIP
QVKKEIAKALMPTAGVSDPSICTQEVAWDEGHPPPGPQDPEDVVTLEATC
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggtggccgtgctggatcttgtgaccttcctggtcgtcctgaagtcggcatgctgtgca
caaccacggccggcgcaagacaaaatatcccctattataaacatgcagctggattcaagg
aaaaaaatgttaacctggacttacaccagaaacgtgagtcaccaggaatgcacaatagat
acgcccactgcctattccgccacggtgaacccacaggtgacggaggaccacacctacgtc
tgcaccttccccaactccgtgctgcacaggggggccaacctgaccgtgaacgtcacttgc
gacggggatgtgttcctccaagtcctgactttcgccaacccaggcagggaaggttccgga
gccgtgaacttctcctgcctcatttacaacgtgcgcttaatgaactgcagctgggcgccc
ggcccggccgccccggccgacgtcaagtatcgactgttctgggcgtccaggcatgaggcc
gacgcggaatgcgtccattacatcctcggccccacggggacccgcgtgggctgccatttc
gaccaactgggcaaaccccagaggacggataattacttcttcttggtgaacggaaccagc
agggaaacggcgatcccgtttttggatttcactccatttaaggccgttcaaatcgagaag
tacaatccaccgaggaacatcaccatcacctacaaccggtcgcaccacatcatccggtgg
gaacatcccgagatccgattcgacctttcaagtcacatgctgtattacgagctgcacatc
caaacgccggcgagctccgcagaaacaaaccgtgttttccagaggggacaggaccccaac
gtgtacctgatgcccagttccgccaccagagccaagagcgccttccgggtgagggtgcgt
tacatgtacaaccgactgtggagcgaatggagccccacgcagcggttcggcctcccggag
caggatttcagtggcgccctggtggggcccgtggtggggaccgcggctttgtccgcgctc
gtcctcaagttcctctgcaaacggttctccgtgaggcgcaagatgttccctcccatcccg
caggtgaagaaggaaatcgccaaggccctcatgcccacagcgggggtgagtgacccctcc
atctgcacccaggaggtcgcctgggacgagggccaccccccgccgggcccccaggacccc
gaggacgtggtgacgctggaggcaacgtgctga

DBGET integrated database retrieval system