KEGG   Felis catus (domestic cat): 101100765
Entry
101100765         CDS       T02385                                 
Symbol
VTN
Name
(RefSeq) vitronectin
  KO
K06251  vitronectin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04512  ECM-receptor interaction
fca04610  Complement and coagulation cascades
fca05165  Human papillomavirus infection
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101100765 (VTN)
  09133 Signaling molecules and interaction
   04512 ECM-receptor interaction
    101100765 (VTN)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101100765 (VTN)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101100765 (VTN)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101100765 (VTN)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101100765 (VTN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101100765 (VTN)
   00536 Glycosaminoglycan binding proteins [BR:fca00536]
    101100765 (VTN)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101100765 (VTN)
Glycosaminoglycan binding proteins [BR:fca00536]
 Heparan sulfate / Heparin
  Extracellular matrix molecules
   101100765 (VTN)
SSDB
Motif
Pfam: Hemopexin Somatomedin_B
Other DBs
NCBI-GeneID: 101100765
NCBI-ProteinID: XP_003996546
Ensembl: ENSFCAG00000008399
UniProt: M3W9I5
LinkDB
Position
E1:18386989..18389978
AA seq 468 aa
MASPRPLLILALLAWVVLADRESCKGRCTEGFNADRKCQCDELCSYYQSCCEDYVAECKP
QVTRGDVFTLPEDEYGVYNYFEETRDNSSVLPQPESTSQGPDLQAQTEVSPDQETFEEPL
LNPTQETLGPETSDQDIPESPVVEELCSGKPFDAFTDLKNGSLFAFRGQYCYELDEEAVS
PGYPKLIQDVWGIEGPIDAAFTRINCQGKTYLFQGHQYWRFEDGVLDPDYPRNISEGFKG
IPDNVDAALALPAHSYSGRERAYFFKGRQYWEYEFQQQPSQEECEGSSLSAVFEHFALLQ
RDSWETLFEFLFGNRFSGGAGQPRLISRDWPGVPRQVDAAMAGRIYISGSAPQSWAEKQK
SRRRNRKRYRSRRNRGRGRSQNPHRQSRSAWLSWLSSEEDSLGIYNFRDYDMDWLVPATC
EPIQSVYFFSGDKYYRVNLRTRQVDTVSPPYPRSIAQYWLGCPAPGHQ
NT seq 1407 nt   +upstreamnt  +downstreamnt
atggcatccccaaggcccctactgatacttgccctgctggcatgggttgttctggctgac
cgagagtcgtgcaagggccgctgcacagagggcttcaacgctgacaggaagtgccagtgt
gacgagctctgctcatactaccagagctgctgtgaggactacgtggctgagtgcaaaccc
caagtgacgcgtggggatgtattcactctgccagaagatgagtacggggtctacaactac
tttgaggagaccagagacaacagcagtgtcctcccacagccagagagcaccagccagggc
cccgatctgcaggcccagactgaagtgtctcctgaccaggagaccttcgaggaaccttta
ctgaaccctacacaggagaccctggggccggagacctctgatcaagacatccctgagtcc
ccggtggtggaagagctatgcagtgggaagccctttgacgccttcactgacctcaagaat
ggctccctctttgccttccgagggcagtactgttatgaactggatgaagaggcagtgagc
cctgggtaccccaagcttatccaagatgtctggggcattgagggccccattgatgctgcc
ttcacccgcatcaactgccaggggaagacctacctcttccagggtcatcagtactggcgc
ttcgaggatggtgttctggacccagattacccccgcaacatctctgaaggcttcaagggc
attccggacaacgtggatgcagccttggctctccctgctcatagctacagtggccgggag
cgggcctacttcttcaaggggagacagtactgggagtatgagttccagcagcagcccagt
caggaggaatgtgaaggcagctccctgtccgcagtgtttgaacactttgccctgctgcag
cgcgacagctgggagaccctctttgaatttctcttcgggaacagattctctggcggtgct
ggacagccccggctcatcagccgggactggcctggtgtgcccaggcaagtggatgcggcc
atggccggccgcatctacatctcaggctcagctccccaatcctgggccgagaagcagaag
tctaggcggcgtaaccgtaaacgctaccgctcacgccgtaaccgtggccgaggccgcagc
cagaacccccaccggcagtcccgttcagcctggctgtcctggctctccagtgaggaggac
agcctgggcatctacaactttcgtgactacgacatggactggcttgtgcctgccacctgc
gagcccatccaaagtgtttacttcttctcaggagacaagtactaccgagtcaaccttcgc
acacggcaagtggacaccgtgagccctccttacccacgctccatcgcccagtactggctg
ggctgcccagcccctggccaccagtag

DBGET integrated database retrieval system