KEGG   Felis catus (domestic cat): 101100840
Entry
101100840         CDS       T02385                                 
Symbol
MBL2
Name
(RefSeq) mannose-binding protein C
  KO
K03991  mannose-binding lectin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04610  Complement and coagulation cascades
fca05150  Staphylococcus aureus infection
fca05171  Coronavirus disease - COVID-19
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    101100840 (MBL2)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101100840 (MBL2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    101100840 (MBL2)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101100840 (MBL2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101100840 (MBL2)
  09183 Protein families: signaling and cellular processes
   04091 Lectins [BR:fca04091]
    101100840 (MBL2)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Opsonins
    101100840 (MBL2)
Lectins [BR:fca04091]
 C-Type lectins
  Group 3: Collectins
   101100840 (MBL2)
SSDB
Motif
Pfam: Lectin_C Collagen DUF5595
Other DBs
NCBI-GeneID: 101100840
NCBI-ProteinID: XP_019668946
UniProt: A0A2I2UI11
LinkDB
Position
D2:complement(41723663..41729094)
AA seq 243 aa
MFLSSSLPVLLLCMLTASSSEIKISEDALKTCSAIACGIPGRDGRDGPKGEKGEPGQGLR
GLQGPPGKMGPPGNTGPPGAPGIKGTKGDRGDNSVVEAKLANLEAEMRRLKSELDHVEKL
QAFSLGKTPGKKFYVTNGERMPFSKVKAQCAELQGTVATPKNAEENKAIQDMAGSPAFLG
ITDEVTEGRFMYVTGGRLAYSNWKRDEPNDHGSGEDCVILLQDGLWNDISCSSSFLAVCE
FPA
NT seq 732 nt   +upstreamnt  +downstreamnt
atgttcctgtcttcatcacttcctgtcctccttctgtgcatgctgacagcatccagctca
gaaataaaaatctccgaggatgccctgaagacctgctcagcgatcgcctgtggcatccca
ggcagagatggacgagatggacccaagggagaaaagggggaaccagggcaggggctcaga
ggcttgcagggccctccggggaaaatggggcctccgggaaacacagggcctcctggggct
ccaggaataaagggcaccaaaggagaccgtggagacaattcagttgtggaggcgaagctg
gctaacctggaggcagagatgaggagactgaaatcggaactggaccatgtcgaaaagttg
caagccttctccttgggcaaaacacctgggaagaagttctacgtgaccaacggtgaaaga
atgcctttttccaaagtgaaggcccagtgcgccgagctccagggcaccgtggccacgccg
aagaacgctgaggagaataaagccatccaggatatggccggcagccctgccttcctgggc
atcacggacgaagtgactgaaggccggtttatgtacgtgacgggagggaggcttgcctac
agcaactggaagagggatgagcctaatgaccacggctccggggaggattgtgtcatcctc
ctccaggacgggctctggaatgacatttcctgctcttcctccttcctggccgtctgtgaa
ttcccagcctga

DBGET integrated database retrieval system