KEGG   Felis catus (domestic cat): 101101143
Entry
101101143         CDS       T02385                                 
Symbol
AICDA
Name
(RefSeq) single-stranded DNA cytosine deaminase
  KO
K10989  activation-induced cytidine deaminase [EC:3.5.4.38]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04672  Intestinal immune network for IgA production
fca05340  Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    101101143 (AICDA)
 09160 Human Diseases
  09163 Immune disease
   05340 Primary immunodeficiency
    101101143 (AICDA)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.38  single-stranded DNA cytosine deaminase
     101101143 (AICDA)
SSDB
Motif
Pfam: NAD1 APOBEC2 APOBEC_N NAD2 APOBEC3 SNAD4 APOBEC_C APOBEC4_like APOBEC4 APOBEC1 RbcX
Other DBs
NCBI-GeneID: 101101143
NCBI-ProteinID: XP_023112519
LinkDB
Position
B4:complement(43208634..43219432)
AA seq 198 aa
MDSLLMKQRKFLYHFKNVRWAKGRHETYLCYVVKRRDSATSFSLDFGHLRNKNGCHVELL
FLRYISDWDLDPGRCYRVTWFTSWSPCYDCARHVADFLRGYPNLSLRIFTARLYFCEDRK
AEPEGLRRLHRAGVQIAIMTFKDYFYCWNTFVENREKTFKAWEGLHENSVRLSRQLRRIL
LPLYEVDDLRDAFRTLGL
NT seq 597 nt   +upstreamnt  +downstreamnt
atggacagcctcctgatgaagcagaggaagtttctctaccatttcaagaatgtccgctgg
gctaagggtcgccatgagacctacttgtgctacgtggtgaagcggcgggacagtgccacc
tccttttcattggacttcggtcaccttcgaaacaagaacggctgccacgtggaactgctc
ttcctccgctacatctccgactgggacctggaccctggccgctgctaccgcgtcacctgg
ttcacctcctggagcccctgctacgactgcgcccggcacgtggccgactttctgaggggg
taccccaacctcagtctgaggatcttcaccgcgcgcctctacttctgcgaggaccgcaag
gccgagcccgaggggctgcggcgcctgcaccgcgcgggcgtccaaatcgccatcatgacc
ttcaaagattatttttattgctggaatacttttgtggaaaatcgtgaaaaaactttcaaa
gcctgggaggggttgcacgaaaactcagttcgtctatccagacagcttcgacgcattctt
ttgccgctgtatgaggttgatgacttgagagatgcatttcgtactttgggactttga

DBGET integrated database retrieval system