KEGG   Felis catus (domestic cat): 101101212
Entry
101101212         CDS       T02385                                 
Name
(RefSeq) beta-defensin 103A
  KO
K23126  beta-defensin 103
Organism
fca  Felis catus (domestic cat)
Pathway
fca04621  NOD-like receptor signaling pathway
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101101212
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    101101212
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101101212
Transporters [BR:fca02000]
 Other transporters
  Pores ion channels [TC:1]
   101101212
SSDB
Motif
Pfam: Defensin_beta Defensin_beta_2
Other DBs
NCBI-GeneID: 101101212
NCBI-ProteinID: XP_003984601
LinkDB
Position
B1:complement(6973436..6974787)
AA seq 94 aa
MAVSCNPYKVDEHTFLPSLSVLRSLPAMRIYYLLFVLPFLFLMPVPGNGGIISLLQKQFC
SLRSGRCALLTCLPKEEQIGRCSLSGRKCCRRKK
NT seq 285 nt   +upstreamnt  +downstreamnt
atggctgtgtcctgcaatccttataaagtggacgaacacaccttcctacccagtctcagc
gtgctgcgaagcctgccggccatgagaatctattatctcctcttcgtgttgcccttcctg
ttcttgatgcctgttccaggaaatggaggaattataagcctcctgcagaagcagttttgc
agtttgagaagcggccggtgcgctctgctaacctgccttccaaaggaggagcaaatcggc
cgatgctctctcagcggccgaaagtgctgccgaagaaagaaataa

KEGG   Felis catus (domestic cat): 102902220
Entry
102902220         CDS       T02385                                 
Symbol
DEFB1
Name
(RefSeq) beta-defensin 1
  KO
K23125  beta-defensin 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca02010  ABC transporters
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    102902220 (DEFB1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    102902220 (DEFB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    102902220 (DEFB1)
   03037 Cilium and associated proteins [BR:fca03037]
    102902220 (DEFB1)
Transporters [BR:fca02000]
 Other transporters
  Pores ion channels [TC:1]
   102902220 (DEFB1)
Cilium and associated proteins [BR:fca03037]
 Motile cilia and associated proteins
  Sperm associated proteins
   102902220 (DEFB1)
SSDB
Motif
Pfam: Defensin_beta Defb50
Other DBs
NCBI-GeneID: 102902220
NCBI-ProteinID: XP_006930602
LinkDB
Position
B1:complement(6861332..6874111)
AA seq 68 aa
MKALCFLLLALCLLSRLAPGAAFLTGLGQRSDHYICARKGGTCNFSPCPLFTRIDGTCYG
GKAKCCMR
NT seq 207 nt   +upstreamnt  +downstreamnt
atgaaggctctctgcttcctgctgctggcgctgtgcctcctctcccgcctggccccaggt
gctgcctttctcacgggtctcggccagcggtctgaccactacatatgtgccaggaaagga
ggaacctgtaacttttctccatgcccactttttaccaggatcgatggcacctgctatggt
ggaaaggccaagtgctgcatgcgctga

DBGET integrated database retrieval system