KEGG   Felis catus (domestic cat): 105260732
Entry
105260732         CDS       T02385                                 
Symbol
CLEC6A
Name
(RefSeq) C-type lectin domain family 6 member A isoform X1
  KO
K17514  C-type lectin domain family 6 member A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04625  C-type lectin receptor signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    105260732 (CLEC6A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    105260732 (CLEC6A)
   04091 Lectins [BR:fca04091]
    105260732 (CLEC6A)
Pattern recognition receptors [BR:fca04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   105260732 (CLEC6A)
Lectins [BR:fca04091]
 C-Type lectins
  Group 2: Type II membrane receptors (Asialoglycprotien and DC receptors)
   Macrophage receptos
    105260732 (CLEC6A)
SSDB
Motif
Pfam: Lectin_C DUF6452
Other DBs
NCBI-GeneID: 105260732
NCBI-ProteinID: XP_019690017
UniProt: A0A337SI37
LinkDB
Position
B4:complement(42716254..42736854)
AA seq 212 aa
MVREGPPQDREKAVWRSQVRFWSVAVISIALLSACFIVSCVVTYHLTYGKTGQRLSELHT
RHSGLTCFSEGTSMRENVWACCPCAWKSFGSSCYFISTQQNFWSKSEQNCVAMGAHLVVI
NTEAEQNFLVQQLNESLSYFLGLSDTQGNDNWQWIDQTPYKENVRLWHQNEPNFSAEECA
SIVFWENRGWGWNDVFCDTKRNSICEMKKIYL
NT seq 639 nt   +upstreamnt  +downstreamnt
atggtacgagaagggccacctcaagatagagagaaagcagtatggcggtcccaagtaaga
ttctggtctgttgctgtgatttccatagcactcctcagtgcttgtttcattgtgagctgt
gtggtgacttatcatcttacatatggcaaaactggccaaaggctgtctgaactacacaca
cgccactcaggtttaacctgcttcagtgaagggacaagcatgagagagaatgtctgggca
tgttgcccatgtgcttggaagtcatttggttccagctgctacttcatttctactcagcag
aatttttggtcaaagagtgaacagaactgtgttgcaatgggtgctcacttggtggtgatc
aacacagaagcagagcagaatttccttgtccagcaactgaatgaatcattgtcttatttt
ctgggactctcagatacacaagggaatgacaattggcaatggattgatcagacaccttac
aaggaaaatgtcagattatggcaccagaatgagcccaatttttctgcagaggaatgtgct
tcaatagttttctgggaaaacagaggatggggctggaatgatgttttctgtgatactaag
agaaactcaatatgtgagatgaagaagatttatctctga

DBGET integrated database retrieval system