KEGG   Felis catus (domestic cat): 105261212
Entry
105261212         CDS       T02385                                 
Symbol
FCAR
Name
(RefSeq) immunoglobulin alpha Fc receptor
  KO
K06513  CD89 antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    105261212 (FCAR)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    105261212 (FCAR)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    105261212 (FCAR)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    105261212 (FCAR)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Fc receptors
    105261212 (FCAR)
CD molecules [BR:fca04090]
 Proteins
  105261212 (FCAR)
SSDB
Motif
Pfam: ig Ig_2 Ig_3 I-set
Other DBs
NCBI-GeneID: 105261212
NCBI-ProteinID: XP_023101816
LinkDB
Position
E2:complement(3676245..3686008)
AA seq 302 aa
MAPRDTIHLCLVLCLSQKLWAQEGYFPIPIISATPGSVIPWNESVKILCWGTPESYLYQL
EILRNLTFEVVEKKLGFQEKAEFLISHMNTNTAGRYQCQYRKEYKLSEHSKTLELVVTGL
YNKPSLSAVQGMVVMLGENISLQCSSTDIPFDRFSLTKEGGATLSQHQSGVHQGNFILGP
VNHNFSGNYRCYGWYSGSPYVWSAPSDALGLVVTDIMNQDYTMENLIRMGVAGLVLVALL
AIVIGNWHSHKVPNKEDWPDFPELSRSQHKCQTGPLDKALRDTRALRGKAYCKPGNKKTL
PS
NT seq 909 nt   +upstreamnt  +downstreamnt
atggcccccagagacaccatccatctctgtctcgtgctctgtctgagccagaagctttgg
gcacaggaagggtatttccccattcctattatatctgccacacctggttctgtgattccc
tggaatgagtctgtgaagatcctgtgttgggggactcctgagtcttacttgtaccaactg
gaaatcctgagaaacctcacatttgaggtggtagagaagaaattgggatttcaggagaag
gctgaattcctcattagccacatgaataccaacactgcagggcgttatcagtgccaatat
aggaaagagtacaaattatcagagcacagcaaaaccctggagctggtggtgacaggcttg
tacaacaaaccgtccctctcagcagtgcagggcatggtggtgatgctgggagagaatatt
tccctgcagtgcagctcaacagacatcccatttgatagattttcactgaccaaagaagga
ggagccaccctgtcacagcaccaaagtggggtacaccaaggcaactttattctaggccct
gtgaaccacaacttctcagggaactacaggtgctatggttggtacagtggcagcccttat
gtgtggtcagcccccagtgatgccctggggcttgtggtcacagatataatgaaccaagat
tacacaatggagaatttgatccgaatgggcgtggcaggactggtccttgtggctctcttg
gccatagtcattggaaattggcacagccataaggttccaaacaaggaagactggccagat
tttcctgaactgagccggagtcaacacaaatgtcagactggacctttggacaaagcctta
agagacaccagggccttgcgtggaaaagcatactgtaaacctgggaataaaaagaccctc
ccctcctag

DBGET integrated database retrieval system