KEGG   Felis catus (domestic cat): 493660
Entry
493660            CDS       T02385                                 
Symbol
TLR1
Name
(RefSeq) toll-like receptor 1
  KO
K05398  toll-like receptor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04620  Toll-like receptor signaling pathway
fca05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493660 (TLR1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    493660 (TLR1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    493660 (TLR1)
   04090 CD molecules [BR:fca04090]
    493660 (TLR1)
Pattern recognition receptors [BR:fca04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   493660 (TLR1)
CD molecules [BR:fca04090]
 Proteins
  493660 (TLR1)
SSDB
Motif
Pfam: TIR LRR_8 LRR_4 TIR_2 LRRCT
Other DBs
NCBI-GeneID: 493660
NCBI-ProteinID: XP_003985489
Ensembl: ENSFCAG00000031748
UniProt: A0A5F5XZ29
LinkDB
Position
B1:175476558..175527863
AA seq 789 aa
MMKTNSSIFHFAIIFMLILETKIQLTDESEFLVDRSESSLFHVPKNLSLKTTILNISQNY
ISELRTSDIISLSKLRILIVSHNRIQYLDISVFKFNQELEYLDLSHNELWKISCHPTVNL
KHLDLSFNAFVGLPICKEFGNMSQLEFLGLSATQLQKSSVLPIASLHISKVLLVLGDAYG
EKEDPESLQNFNIESLHIIFPTRKEFSFILDVSVSTAVSLELSNIKCVLDDNGCSYFQNV
LLKLQNNSRLSNLTLNNIETTWNFFIMIIQLVWHTSIKYFSISNVKLQGHLDFRDFDYSN
TSLKAFSIHQVVTDVFSFPQSHIYEIFSNMNVQNFTVSGTHMVHMVCPSQISTFLYLDFS
NNLLTDMVFKNCGNLAKLETLSLQMNQLKELASIVYMTKEMKSLQQLDVSQNSLRYDKNE
GDCSWTTSLLSLNMSSNILTDSVFRCLPPKVKVLDLHNNQIRSIPKPIMKLEALQELNVA
SNSLAHLPDCGAFSSLSVLIIDHNSISNPSADFFHSCQKIRSIRAGNNPFQCTCELREFI
QNIGQASSEVVEGWPDSYKCDYPESYKGTPLKDFHVSQLSCNTALLLVTIGVTVLVLTVT
VTALCMYFDLPWYLRMVCQWTQTRHRARKLPLEELQRTLQFHAFISYSGHDSVWVKSELL
PNLEKEDLRICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAHH
NLFHEGFDNLILILLEPIPQYSIPSSYHKLKNLMARRTYLEWPKEKSKHGLFWANLRAAI
NVKLMERAK
NT seq 2370 nt   +upstreamnt  +downstreamnt
atgatgaaaactaattctagcatcttccattttgccatcatcttcatgttaatacttgag
accaaaatccaactgactgatgaaagtgaatttttggttgacagatcagaatcaagtctc
tttcatgttcccaaaaacctatccctgaaaacaacaatcttaaatatatcacaaaactat
atatctgagcttcggacttctgacatcatatcactatcaaagctaaggattttgatagtt
tctcataacagaattcaatatcttgatattagtgttttcaaattcaaccaggaattggaa
tatttggatttgtcccacaatgaattgtggaagatttcttgccatcctactgtgaatctc
aagcatttagacctctcatttaatgcatttgttggcctacccatatgcaaagagtttggc
aatatgtctcaactagaatttctggggttgagtgccacacaattacaaaaatctagtgtg
ctaccaattgcttctttgcatataagtaaggttttactggtcttaggagacgcttatggg
gaaaaagaagaccctgagagccttcaaaactttaatatagaaagtctacacattattttc
cccacaagaaaagaattcagttttattttggatgtatcagtcagcacagcagtaagtctg
gaactttccaatatcaaatgtgtgctagatgataatggatgttcttatttccaaaatgtt
ctgttaaaacttcagaacaactcaaggttatcaaatcttactttaaacaacattgaaaca
acttggaattttttcattatgatcatccagttggtttggcatacaagcataaagtatttc
tcaatttcaaatgtaaaactacaaggtcaccttgacttcagagattttgattattcgaac
acttcactgaaggccttctctatacaccaagtggtcactgatgtgttcagttttccacaa
agtcatatctatgaaatcttttcaaatatgaacgtccaaaatttcacagtgtctggtaca
catatggtccacatggtttgtccatcccaaattagcacatttttatatttggatttttct
aataatctcttaacagacatggttttcaaaaactgtggaaacttggctaaattagagaca
cttagtttacaaatgaatcaattaaaagaacttgcaagtatagtttatatgaccaaagag
atgaagtctctacaacaattggatgttagtcagaattctctaaggtatgataaaaatgaa
ggagattgctcttggactacaagtttattaagtttaaatatgtcttcaaatatacttacg
gactctgttttcagatgtttacctcctaaggtcaaggtacttgatcttcacaataaccaa
ataagaagcattcctaaaccaatcatgaaactagaagctttgcaagaactcaatgttgcc
tccaattccttagcccaccttcctgactgtggagcttttagcagcctttctgtactgatc
attgaccataattcaatttccaacccatcagctgatttcttccacagctgccagaagatt
aggtccataagagcaggaaacaatccattccaatgcacctgtgagctaagagaatttatc
cagaatataggccaagcatcaagtgaagtggtagagggttggcctgattcttataagtgt
gactatccagaaagttataagggaaccccactaaaggactttcatgtgtctcagttatcc
tgcaacacagctctgctgcttgtcaccattggggtcactgtgctggtgttgactgttact
gtgactgccctctgtatgtactttgatctgccctggtatctcaggatggtgtgtcagtgg
acccagacccggcacagggcaaggaaactacccttagaagaactccaaagaacccttcag
ttccacgcttttatttcatatagtgggcatgattctgtgtgggtgaagagtgaattatta
ccaaacctagaaaaagaagacctaaggatttgtctccatgagagaaactttgttcctggc
aagagcattgtggagaatatcatcaactgcattgaaaaaagttacaagtccatctttgtt
ttgtctcccaactttgttcagagtgagtggtgtcattatgaactctactttgcccaccac
aatctatttcatgaaggttttgataacttaattttaatcttgctggagcctattccacag
tattccattcctagcagctatcacaagctcaaaaatctcatggcacgaaggacttatttg
gaatggcccaaggagaagagcaaacatggacttttttgggctaacctaagagcagctatt
aatgttaaattgatggagcgagcaaaataa

KEGG   Felis catus (domestic cat): 493662
Entry
493662            CDS       T02385                                 
Symbol
TLR6
Name
(RefSeq) toll-like receptor 6
  KO
K10169  toll-like receptor 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca04145  Phagosome
fca04620  Toll-like receptor signaling pathway
fca05132  Salmonella infection
fca05142  Chagas disease
fca05152  Tuberculosis
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    493662 (TLR6)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493662 (TLR6)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493662 (TLR6)
   05152 Tuberculosis
    493662 (TLR6)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    493662 (TLR6)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493662 (TLR6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    493662 (TLR6)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:fca04054]
    493662 (TLR6)
   04090 CD molecules [BR:fca04090]
    493662 (TLR6)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Phagocytosis
   Toll-like receptors
    493662 (TLR6)
Pattern recognition receptors [BR:fca04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   493662 (TLR6)
CD molecules [BR:fca04090]
 Proteins
  493662 (TLR6)
SSDB
Motif
Pfam: TIR TIR_2 LRR_8 LRR_4 LRR_6 LRRCT
Other DBs
NCBI-GeneID: 493662
NCBI-ProteinID: XP_003985516
Ensembl: ENSFCAG00000022203
LinkDB
Position
B1:175476544..175496117
AA seq 804 aa
MTKDKESITRSFCFVYILTLIVGTIIQFSDESEFAVDMSKMKLTHVPKDLSPKTKVLDIS
QNYISKLHISDISYLLGLEVLTLSYNRLQCLDFSIFKFNQDLEYLDLSHNQLQKTSCHLI
RSLKHLDLSFNDFDVLPICKEFGNLTQLNFLGLSGTRLRQLDLLPIAHLHLSHILLDLEG
YYAKESETESLQILNTKTLHLVFHPNQLFSVQVNISVNSLRCLQLTNIKLNNDNCQILIK
FLSELIRGPTLLNFTLKHVETTWKCLVRVFQFLWPKPVEYLNIYNLIIVESIDEEDFTYS
KTALKALKIEHVTNRVFIYSQTVLYTFFSEMNIMMLTLSDTPFIHMLCPQTSSTFKFLNF
TQNVFTDSVFQNCSKLVRLETLILQKNKLKGLYNIGLMTKHMTSLEILDVSWNSLEYDRH
DGNCTWGGSIVVLNLSSNILTDSVFRCLPPKVKVLDLYDNRIRSIPKLIMKLEALQELNV
ASNSLAHLPDCGAFSSLSVLIIDHNSISNPSADFFHSCQKIRSIRAGNNPFQCTCELREF
IQNIGQVSSEVVEGWPDSYKCDNPESYKGTPLKDFHVSQLSCNTALLLVTIGVTVLVLTV
TVTALCMYFDLPWYLRMVCQWTQTRHRARNLPLEELQRTLQFHAFISYSEHDSAWVKNEL
VPYLEKEDLRICLHERNFVPGKSIVENIINCIEKSYKSIFVLSPNFVQSEWCHYELYFAH
HNLFHEGSNNLILILLEPIPQNCIPSKYHKLKALMTQRTYLEWPKEKSKHGLFWANIRAA
FNMKLTLIAENNNAETYKKSGNSI
NT seq 2415 nt   +upstreamnt  +downstreamnt
atgaccaaagacaaagaatctatcaccagaagcttttgctttgtgtacattttgacctta
atagttggaaccataatccagttctctgatgaaagtgaatttgcagtagacatgtcaaaa
atgaaacttacgcatgttccaaaagacctgtcaccaaaaaccaaagtcttagatatatct
caaaactacatatctaagcttcacatctctgacattagctatctcttagggctggaagtt
ttgacactttcctataatagactccagtgcctcgattttagcattttcaagttcaaccag
gatttggaatatttggatttatctcacaatcagttgcagaagacctcttgccaccttatc
aggagtctcaagcatttagacctctcattcaatgactttgatgtcctgcccatctgtaag
gaatttggcaacttgacgcaactgaatttcttaggattaagtggtacaaggttacgacaa
ttagatctgctaccaattgctcatttgcatctaagtcacatccttctggatttagaaggt
tattatgcaaaagaaagtgaaacagaaagtcttcaaattctgaatacgaaaacacttcac
cttgtttttcacccaaatcagttattctctgtccaagtaaacatatcagttaacagttta
aggtgcttacaactgactaatattaaattgaataacgacaactgtcaaattctaattaaa
tttttatcagaactcattagaggcccaactttactgaattttactctcaaacatgtggaa
acaacttggaaatgcctggttagagtttttcaatttctttggcccaaacctgtagaatat
ctcaatatttacaatttaataatagttgaaagcattgatgaagaagattttacttattct
aaaacagcactgaaagcattgaaaatagagcatgttacaaacagagtttttatttattca
cagacggtgttatatacatttttttctgagatgaacattatgatgttaaccctatcagat
acaccttttatacacatgctttgtcctcagacatcaagcacatttaaatttttgaacttt
acccagaatgttttcacagacagtgtatttcaaaactgttccaaactcgttagattggaa
acccttatcttacaaaagaataaattaaaaggcctttacaatataggtctcatgactaag
catatgacatctttggaaatattggatgttagttggaattctttggaatatgatagacat
gatggaaattgcacttggggtgggagtatagtggtgttaaatttgtcttcaaatatactt
actgactctgttttcagatgtttacctcctaaggtcaaggtacttgatctttatgataac
cgaataaggagcattcctaaactaatcatgaaactagaagctttgcaagaactcaatgtt
gcctccaattccttagcccaccttcctgactgtggagcttttagcagcctttctgtactg
atcattgaccataattcaatttccaacccatcagctgatttcttccacagctgccagaag
attaggtccataagagcaggaaacaatccattccaatgcacctgtgagctaagagaattt
atccagaatataggccaagtatcaagtgaagtggtagagggttggcctgattcttataag
tgtgacaatccagaaagttataagggaaccccactaaaggactttcatgtgtctcagtta
tcctgcaacacagctctgctgcttgtcaccattggggtcactgtgctggtgttgactgtt
actgtgactgccctctgtatgtactttgatctgccctggtatctcaggatggtgtgtcag
tggacccagacccggcacagggcaaggaacctacccttagaagaactccaaagaaccctt
cagttccatgcttttatttcatacagtgaacacgattctgcctgggtgaagaatgaactg
gtaccttacctagaaaaagaagacctaaggatttgtctccatgagagaaactttgttcct
ggcaagagcattgtggaaaatatcatcaactgcattgagaaaagttacaagtccatcttt
gttttgtctcccaactttgttcagagtgagtggtgtcattatgaactctactttgctcat
cacaatctctttcacgaaggatctaataatttaatcctgatcttgctggaacccattcca
cagaactgcattcccagcaagtatcacaagctgaaggctctcatgacacagcggacttac
ttggaatggcccaaggagaagagcaaacatggacttttttgggctaatattagagctgct
tttaacatgaagttgacattaattgctgaaaacaataatgcagaaacttataaaaagtca
ggaaattcaatttaa

DBGET integrated database retrieval system