KEGG   Felis catus (domestic cat): 493701
Entry
493701            CDS       T02385                                 
Symbol
BCL2L1
Name
(RefSeq) bcl-2-like protein 1
  KO
K04570  Bcl-2-like 1 (apoptosis regulator Bcl-X)
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01524  Platinum drug resistance
fca04014  Ras signaling pathway
fca04064  NF-kappa B signaling pathway
fca04115  p53 signaling pathway
fca04137  Mitophagy - animal
fca04140  Autophagy - animal
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04621  NOD-like receptor signaling pathway
fca04630  JAK-STAT signaling pathway
fca05012  Parkinson disease
fca05014  Amyotrophic lateral sclerosis
fca05022  Pathways of neurodegeneration - multiple diseases
fca05145  Toxoplasmosis
fca05162  Measles
fca05166  Human T-cell leukemia virus 1 infection
fca05168  Herpes simplex virus 1 infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05212  Pancreatic cancer
fca05220  Chronic myeloid leukemia
fca05222  Small cell lung cancer
fca05225  Hepatocellular carcinoma
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    493701 (BCL2L1)
   04630 JAK-STAT signaling pathway
    493701 (BCL2L1)
   04064 NF-kappa B signaling pathway
    493701 (BCL2L1)
   04151 PI3K-Akt signaling pathway
    493701 (BCL2L1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    493701 (BCL2L1)
   04137 Mitophagy - animal
    493701 (BCL2L1)
  09143 Cell growth and death
   04210 Apoptosis
    493701 (BCL2L1)
   04215 Apoptosis - multiple species
    493701 (BCL2L1)
   04115 p53 signaling pathway
    493701 (BCL2L1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    493701 (BCL2L1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493701 (BCL2L1)
   05202 Transcriptional misregulation in cancer
    493701 (BCL2L1)
  09162 Cancer: specific types
   05212 Pancreatic cancer
    493701 (BCL2L1)
   05225 Hepatocellular carcinoma
    493701 (BCL2L1)
   05220 Chronic myeloid leukemia
    493701 (BCL2L1)
   05222 Small cell lung cancer
    493701 (BCL2L1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    493701 (BCL2L1)
   05170 Human immunodeficiency virus 1 infection
    493701 (BCL2L1)
   05162 Measles
    493701 (BCL2L1)
   05168 Herpes simplex virus 1 infection
    493701 (BCL2L1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    493701 (BCL2L1)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    493701 (BCL2L1)
   05014 Amyotrophic lateral sclerosis
    493701 (BCL2L1)
   05022 Pathways of neurodegeneration - multiple diseases
    493701 (BCL2L1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493701 (BCL2L1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    493701 (BCL2L1)
   01524 Platinum drug resistance
    493701 (BCL2L1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    493701 (BCL2L1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    493701 (BCL2L1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    493701 (BCL2L1)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     493701 (BCL2L1)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic type
  Centrosome formation proteins
   Other centriole associated proteins
    493701 (BCL2L1)
Transporters [BR:fca02000]
 Other transporters
  Pores ion channels [TC:1]
   493701 (BCL2L1)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 493701
NCBI-ProteinID: NP_001009228
Ensembl: ENSFCAG00000025748
UniProt: Q8SQ42
LinkDB
Position
A3:27267680..27313279
AA seq 233 aa
MSQSNRELVVDFLSYKLSQKGYSWSRFSDVEENRTEAPEGTESEMETPSAINGNPSWHLA
DSPAVNGATGHSSSLDAREVIPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAY
QSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQVLVSRIAAWMATYLNDHLEP
WIQENGGWDTFVELYGNNAAAESRKGQERSNRWFLTGMTVAGVVLLGSLFSRK
NT seq 702 nt   +upstreamnt  +downstreamnt
atgtctcagagcaaccgggagctggtggttgactttctctcctacaagctttcccagaaa
ggatacagctggagtcggtttagtgatgtggaagagaacagaactgaggccccagaaggg
actgaatcagagatggagacccccagtgccatcaatggcaacccatcctggcacttggca
gacagccctgcggtgaatggagccactggccacagcagcagcttggatgcccgggaggtg
atccccatggcagcggtcaaacaagcgctgagggaggctggggatgagtttgaactgagg
taccggcgggcattcagtgacctgacatcccagcttcacatcaccccagggacagcatat
cagagctttgagcaggtagtgaatgaactcttccgggatggggtgaactggggtcgcatt
gtggcctttttctccttcggtggggcactgtgcgtggagagcgtagacaaggagatgcag
gtattggtgagtcggatcgcagcttggatggccacttacctgaatgaccacctagagcct
tggatccaggagaacggcggctgggatacttttgtggaactctacgggaacaatgcagca
gccgagagccggaagggccaggagcgctccaaccgctggttcctgacaggcatgactgtg
gctggcgtggttctgctgggctcactcttcagtcggaaatga

KEGG   Felis catus (domestic cat): 493934
Entry
493934            CDS       T02385                                 
Symbol
BCL2
Name
(RefSeq) apoptosis regulator Bcl-2
  KO
K02161  apoptosis regulator Bcl-2
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca01524  Platinum drug resistance
fca04064  NF-kappa B signaling pathway
fca04066  HIF-1 signaling pathway
fca04071  Sphingolipid signaling pathway
fca04115  p53 signaling pathway
fca04140  Autophagy - animal
fca04141  Protein processing in endoplasmic reticulum
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04217  Necroptosis
fca04261  Adrenergic signaling in cardiomyocytes
fca04340  Hedgehog signaling pathway
fca04510  Focal adhesion
fca04621  NOD-like receptor signaling pathway
fca04630  JAK-STAT signaling pathway
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04915  Estrogen signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05014  Amyotrophic lateral sclerosis
fca05022  Pathways of neurodegeneration - multiple diseases
fca05132  Salmonella infection
fca05145  Toxoplasmosis
fca05152  Tuberculosis
fca05161  Hepatitis B
fca05162  Measles
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05207  Chemical carcinogenesis - receptor activation
fca05210  Colorectal cancer
fca05215  Prostate cancer
fca05222  Small cell lung cancer
fca05226  Gastric cancer
fca05417  Lipid and atherosclerosis
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    493934 (BCL2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    493934 (BCL2)
   04630 JAK-STAT signaling pathway
    493934 (BCL2)
   04064 NF-kappa B signaling pathway
    493934 (BCL2)
   04066 HIF-1 signaling pathway
    493934 (BCL2)
   04071 Sphingolipid signaling pathway
    493934 (BCL2)
   04151 PI3K-Akt signaling pathway
    493934 (BCL2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    493934 (BCL2)
  09143 Cell growth and death
   04210 Apoptosis
    493934 (BCL2)
   04215 Apoptosis - multiple species
    493934 (BCL2)
   04217 Necroptosis
    493934 (BCL2)
   04115 p53 signaling pathway
    493934 (BCL2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    493934 (BCL2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    493934 (BCL2)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    493934 (BCL2)
   04928 Parathyroid hormone synthesis, secretion and action
    493934 (BCL2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    493934 (BCL2)
  09156 Nervous system
   04725 Cholinergic synapse
    493934 (BCL2)
   04722 Neurotrophin signaling pathway
    493934 (BCL2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493934 (BCL2)
   05206 MicroRNAs in cancer
    493934 (BCL2)
   05207 Chemical carcinogenesis - receptor activation
    493934 (BCL2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    493934 (BCL2)
   05226 Gastric cancer
    493934 (BCL2)
   05215 Prostate cancer
    493934 (BCL2)
   05222 Small cell lung cancer
    493934 (BCL2)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493934 (BCL2)
   05161 Hepatitis B
    493934 (BCL2)
   05162 Measles
    493934 (BCL2)
   05168 Herpes simplex virus 1 infection
    493934 (BCL2)
   05169 Epstein-Barr virus infection
    493934 (BCL2)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    493934 (BCL2)
   05152 Tuberculosis
    493934 (BCL2)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    493934 (BCL2)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis
    493934 (BCL2)
   05022 Pathways of neurodegeneration - multiple diseases
    493934 (BCL2)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    493934 (BCL2)
   05418 Fluid shear stress and atherosclerosis
    493934 (BCL2)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    493934 (BCL2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    493934 (BCL2)
   01524 Platinum drug resistance
    493934 (BCL2)
   01522 Endocrine resistance
    493934 (BCL2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    493934 (BCL2)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     493934 (BCL2)
SSDB
Motif
Pfam: Bcl-2 BH4 Bcl-2_3
Other DBs
NCBI-GeneID: 493934
NCBI-ProteinID: NP_001009340
UniProt: Q8I008
LinkDB
Position
D3:complement(83099907..83277501)
AA seq 235 aa
MAHAGRTGYDNREIVMKYIHYELPQRGYEWDAGDAGAAPPGAAPAPGIFSSQPGRTPAPA
RTSPPPPPVAPAAAAAAAGPALSPVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPF
TARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVEGVNREMSPLVDNIALWMTEYLNRH
LHTWIQDNGGWDAFVELYGPSMQPLFDFSWLSLKALLSLALVGACITLGAYLGHK
NT seq 708 nt   +upstreamnt  +downstreamnt
atggcgcacgctgggagaacagggtatgataaccgggagatagtgatgaagtacatccac
tatgagctgccgcagaggggctacgagtgggatgccggggacgcgggcgccgcgcccccg
ggggccgcccccgcgccgggcatcttctcctcccagcccgggcgcacccctgcgcccgcc
aggacctccccgccgccgcccccggtcgcccccgccgccgccgccgctgccgcgggccct
gcgctcagccccgtgccacctgtggtccacctgaccctgcgccaggccggcgatgacttc
tcccgtcgctaccgccgcgacttcgcggagatgtccagccagctgcacctgacacccttt
accgcaaggggacgctttgccacggtggtggaggagctcttcagggatggcgtgaactgg
gggaggattgtggccttctttgagttcggtggggtcatgtgtgtggagggcgtcaaccga
gagatgtcgcccctggtggacaacatcgccctgtggatgactgagtacctgaaccggcac
ctgcacacctggatccaggataacggaggctgggatgcctttgtggaactgtacggcccc
agcatgcagcctctgtttgatttctcctggctgtccctgaaggccctgctcagtctggcc
ctggtgggggcttgcatcaccctgggtgcctatctgggccacaagtga

DBGET integrated database retrieval system