KEGG   Felis catus (domestic cat): 493704
Entry
493704            CDS       T02385                                 
Symbol
CD86
Name
(RefSeq) T-lymphocyte activation antigen CD86 precursor
  KO
K05413  CD86 antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04514  Cell adhesion molecules
fca04620  Toll-like receptor signaling pathway
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05202  Transcriptional misregulation in cancer
fca05320  Autoimmune thyroid disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    493704 (CD86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493704 (CD86)
   04672 Intestinal immune network for IgA production
    493704 (CD86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    493704 (CD86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    493704 (CD86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    493704 (CD86)
   05323 Rheumatoid arthritis
    493704 (CD86)
   05320 Autoimmune thyroid disease
    493704 (CD86)
   05330 Allograft rejection
    493704 (CD86)
   05332 Graft-versus-host disease
    493704 (CD86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    493704 (CD86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    493704 (CD86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    493704 (CD86)
   04090 CD molecules [BR:fca04090]
    493704 (CD86)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   493704 (CD86)
CD molecules [BR:fca04090]
 Proteins
  493704 (CD86)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 C2-set_2 I-set
Other DBs
NCBI-GeneID: 493704
NCBI-ProteinID: NP_001009229
Ensembl: ENSFCAG00000008716
UniProt: Q95L16
LinkDB
Position
C2:67904736..67947763
AA seq 332 aa
MGICDSTMGLSHTLLVMALLLSGVSSMKSQAYFNKTGELPCHFTNSQNISLDELVVFWQD
QDKLVLYEIFRGKENPQNVHLKYKGRTSFDKDNWTLRLHNVQIKDKGTYHCFIHYKGPKG
LVPMHQMSSDLSVLANFSQPEITVTSNRTENSGIINLTCSSIQGYPEPKEMYFQLNTENS
TTKYDTVMKKSQNNVTELYNVSISLPFSVPEAHNVSVFCALKLETLEMLLSLPFNIDAQP
KDKDPEQGHFLWIAAVLVMFVVFCGMVSFKTLRKRKKKQPGPSHECETIKRERKESKQTN
ERVPYHVPERSDEAQCINILKTASGDKSTTHF
NT seq 999 nt   +upstreamnt  +downstreamnt
atgggcatttgtgacagcactatgggactgagtcacactctccttgtgatggccctcctg
ctctctggtgtttcttccatgaagagtcaagcatatttcaacaagactggagaactgcca
tgccattttacaaactctcaaaacataagcctggatgagctggtagtattttggcaggac
caggataagctggttctgtatgagatattcagaggcaaagagaaccctcaaaatgttcat
ctcaaatataagggccgtacaagctttgacaaggacaactggaccctgagactccacaat
gttcagatcaaggacaagggcacatatcactgtttcattcattataaagggcccaaagga
ctagttcccatgcaccaaatgagttctgacctatcagtgcttgctaacttcagtcaacct
gaaataacagtaacttctaatagaacagaaaattctggcatcataaatttgacctgctca
tctatacaaggttacccagaacctaaggagatgtattttcagctaaacactgagaattca
actactaagtatgatactgtcatgaagaaatctcaaaataatgtgacagaactgtacaac
gtttctatcagcttgcctttttcagtccctgaagcacacaatgtgagcgtcttttgtgcc
ctgaaactggagacactggagatgctgctctccctacctttcaatatagatgcacaacct
aaggataaagaccctgaacaaggccacttcctctggattgcggctgtacttgtaatgttt
gttgttttttgtgggatggtgtcctttaaaacactaaggaaaaggaagaagaagcagcct
ggcccctctcatgaatgtgaaaccatcaaaagggagagaaaagagagcaaacagaccaac
gaaagagtaccataccacgtacctgagagatctgatgaagcccagtgtattaacattttg
aagacagcctcaggcgacaaaagtactacacatttttaa

KEGG   Felis catus (domestic cat): 493786
Entry
493786            CDS       T02385                                 
Symbol
CD80
Name
(RefSeq) T-lymphocyte activation antigen CD80
  KO
K05412  CD80 antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04514  Cell adhesion molecules
fca04620  Toll-like receptor signaling pathway
fca04672  Intestinal immune network for IgA production
fca04940  Type I diabetes mellitus
fca05320  Autoimmune thyroid disease
fca05322  Systemic lupus erythematosus
fca05323  Rheumatoid arthritis
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    493786 (CD80)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493786 (CD80)
   04672 Intestinal immune network for IgA production
    493786 (CD80)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    493786 (CD80)
   05323 Rheumatoid arthritis
    493786 (CD80)
   05320 Autoimmune thyroid disease
    493786 (CD80)
   05330 Allograft rejection
    493786 (CD80)
   05332 Graft-versus-host disease
    493786 (CD80)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    493786 (CD80)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    493786 (CD80)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:fca04090]
    493786 (CD80)
CD molecules [BR:fca04090]
 Proteins
  493786 (CD80)
SSDB
Motif
Pfam: V-set I-set Ig_3 Izumo-Ig V-set_CD47 ig Ig_2 PUA_4
Other DBs
NCBI-GeneID: 493786
NCBI-ProteinID: NP_001009253
Ensembl: ENSFCAG00000009585
UniProt: Q95L17
LinkDB
Position
C2:complement(65732038..65775531)
AA seq 173 aa
MGHAAKWKTPLLKHPYPKLFPLLMLASLFYFCSGIIQVNKTVEEVAVLSCDYNISTKELT
EIRIYWQKDDEMVLAVMSGKVQVWPKYKNRTFTDVTDNHSIVIMALRLSDNGKYTCIIQK
IEKGSYKVKHLTSVMLLVRGVTPSTEPNAHAELEIMTLRSRPELRSRVGRLID
NT seq 522 nt   +upstreamnt  +downstreamnt
atgggtcacgcagcaaagtggaaaacaccactactgaagcacccatatcccaagctcttt
ccgctcttgatgctagctagtcttttttacttctgttcaggtatcatccaggtgaacaag
acagtggaagaagtagcagtactatcctgtgattacaacatttccaccaaagaactgacg
gaaattcgaatctattggcaaaaggatgatgaaatggtgttggctgtcatgtctggcaaa
gtacaagtgtggcccaagtacaagaaccgcacattcactgacgtcaccgataaccactcc
attgtgatcatggctctgcgcctgtcagacaatggcaaatacacttgtattattcaaaag
attgaaaaagggtcttacaaagtgaaacacctgacttcggtgatgttattggtcagaggc
gtcacacccagcacagagcccaatgcccatgcggagcttgaaatcatgaccctgagatca
agacctgagctgagatcaagagtcggacgcttaatcgactga

DBGET integrated database retrieval system