KEGG   Folsomia candida: 110843583
Entry
110843583         CDS       T05043                                 

Definition
(RefSeq) isopenicillin N synthase-like
  KO
K04126  isopenicillin-N synthase [EC:1.21.3.1]
Organism
fcd  Folsomia candida
Pathway
fcd00311  Penicillin and cephalosporin biosynthesis
fcd01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    110843583
Enzymes [BR:fcd01000]
 1. Oxidoreductases
  1.21  Catalysing the reaction X-H + Y-H = X-Y
   1.21.3  With oxygen as acceptor
    1.21.3.1  isopenicillin-N synthase
     110843583
SSDB
Motif
Pfam: DIOX_N 2OG-FeII_Oxy Dpp_8_9_N
Other DBs
NCBI-GeneID: 110843583
NCBI-ProteinID: XP_021945242
LinkDB
Position
Unknown
AA seq 333 aa
MPSASNPLVPTIDISPLFGDDKNAKLKVAGEIDQACRGSGFFLISNHGITVLDKLVETTK
KFHQSMTDQEKFDLAIVAYNEKNSKQHRNGYYLPIKGKKAVESYCYLNPTFSSEHPMIKN
SNTPLHEVNVWPDEKKHPGFREFNEDFYFKMFDMSAKLLRGFALALEKEEDFFDSYFKKE
DTLSSVRLIRYPYLEDYPPVKTAADGTKVSFESHQDASLLTVLYQPYVANLQVSMPEGYC
DIPSSDDCFLVNCGGYMAHITNNYYKAPIHRVKFVNAERLSLPFFVMLGYESKIEPFNHS
KHDANAAEAPPAITYGNYFQNARVQLVITNGQT
NT seq 1002 nt   +upstreamnt  +downstreamnt
atgccatctgcatccaacccacttgtgccgaccatcgacatttccccactttttggggac
gataagaatgcaaagttaaaagtcgccggcgaaattgaccaagcatgtcgcggctctgga
ttcttcttaatttcaaaccacggcatcaccgttctcgacaagttggtcgagacgacgaaa
aagttccatcaatcgatgaccgatcaagaaaagtttgacttggcgatcgttgcgtacaac
gagaaaaattcgaaacagcacaggaacgggtattatctcccgatcaaggggaaaaaagcg
gttgaatcttattgctacttaaacccgaccttctccagtgagcatcccatgatcaaaaat
agcaacacacccctccacgaagtcaacgtttggccggatgagaaaaagcatcctggattc
agagaattcaatgaggatttttacttcaagatgttcgacatgtcggcaaaactccttcgc
ggatttgcccttgctcttgaaaaggaggaggatttctttgactcttacttcaagaaggag
gacacattgtcgtcagtgcgacttattcgctacccgtatttggaggactaccctcccgtc
aagacggccgcggatgggacgaaagttagctttgagagtcatcaggatgcttccctcctc
acggtgctgtatcagccatacgtggcaaatttgcaagtaagcatgcctgagggttattgt
gacattccgtcgtcggacgattgttttttggtcaactgtggaggatacatggcccacatt
acgaataattactacaaggctccaattcatcgcgtgaaatttgtcaacgcggagagattg
tcgctcccatttttcgtcatgttgggatatgaaagcaaaattgagccgttcaatcattcg
aaacatgatgccaatgctgcagaagctcctccagcgataacttacgggaattatttccaa
aatgcgagagtccaactggtcattacaaatggtcaaacttaa

DBGET integrated database retrieval system