Folsomia candida: 110860056 Help Entry 110860056         CDS       T05043                                  Name (RefSeq) glutathione S-transferase-like   KO K04097   prostaglandin-H2 D-isomerase / glutathione transferase [EC:5.3.99.2 2.5.1.18] Organism fcd  Folsomia candida Pathway fcd00480   Glutathione metabolism fcd00590   Arachidonic acid metabolism fcd00980   Metabolism of xenobiotics by cytochrome P450 fcd00982   Drug metabolism - cytochrome P450 fcd01100   Metabolic pathways Brite KEGG Orthology (KO) [BR:fcd00001]  09100 Metabolism   09103 Lipid metabolism    00590 Arachidonic acid metabolism     110860056   09106 Metabolism of other amino acids    00480 Glutathione metabolism     110860056   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     110860056    00982 Drug metabolism - cytochrome P450     110860056 Enzymes [BR:fcd01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      110860056  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.99  Other intramolecular oxidoreductases     5.3.99.2  prostaglandin-D synthase      110860056 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  GST_C_3 GST_C GST_C_2 Motif Other DBs NCBI-GeneID:  110860056 NCBI-ProteinID:  XP_021964813 LinkDB All DBs Position Unknown AA seq 126 aa AA seqDB search MYFVFYNPCILPNPADKFVDCTAWVPILMEQDDVKRKRLEQEQKVKSKDQYMDKFEKIVK DNGGRFLVGNKLSWANIYLAHVLNSGELNHGIRFIDEYPALKSMYENVMNTPGIKEWMEK RPDTKY NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgtattttgtattttataacccatgtattttgcccaaccctgctgataaattcgttgat tgcacagcttgggttcccatcctgatggagcaggacgacgtcaaacggaagcggctggaa caggagcagaaggttaaatccaaggatcagtacatggacaagtttgagaaaatcgtgaag gacaacgggggccgtttcctcgtgggaaataagttgagctgggcaaacatttatctggca catgtgctcaacagcggggaactaaatcatgggatacgatttattgatgaatatcccgcc ctcaagtcgatgtatgaaaatgtcatgaacactccagggattaaggaatggatggagaag cggccggataccaagtactaa

DBGET integrated database retrieval system