KEGG   Fragilariopsis cylindrus: FRACYDRAFT_143661
Entry
FRACYDRAFT_143661 CDS       T04784                                 

Definition
(GenBank) tetrahydrobiopterin biosynthesis enzymes-like protein
  KO
K22101  dihydroneopterin triphosphate aldolase (PTPS-III) / 6-pyruvoyltetrahydropterin synthase [EC:4.1.2.60 4.2.3.12]
Organism
fcy  Fragilariopsis cylindrus
Pathway
fcy00790  Folate biosynthesis
fcy01100  Metabolic pathways
fcy01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:fcy00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    FRACYDRAFT_143661
Enzymes [BR:fcy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.60  dihydroneopterin triphosphate aldolase
     FRACYDRAFT_143661
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.12  6-pyruvoyltetrahydropterin synthase
     FRACYDRAFT_143661
SSDB
Motif
Pfam: PTPS
Other DBs
NCBI-ProteinID: OEU13794
JGI: 143661
UniProt: A0A1E7F6Q8
LinkDB
Position
Unknown
AA seq 177 aa
TTNFEVYVSKADFKFNAAHFVAFRGFRERLHGHNYTVGVRLLGSRKISHDGYVMDFGDVK
AVVKKVCKKLNERFLCPIKSDVIDIQIVQQDDVVVGNNSNKSNDCSSKSVILTCEDGAKF
VMPRDDCAMLPIVHATVEELAIYVWSEILIGLDSKILRQRGIHTMEVVMAEAPGQEA
NT seq 531 nt   +upstreamnt  +downstreamnt
acaacaaattttgaagtctacgtgtcgaaagctgattttaaattcaatgcggcacatttc
gttgcgtttcgtggatttcgtgaacgattacacggtcataattacacagtcggtgtacga
ttattaggatcacgtaaaattagtcatgatggatacgtaatggattttggtgacgtaaag
gctgtcgtcaaaaaagtttgtaaaaaattaaatgaacgatttttatgtccaatcaaatcg
gatgttatcgatatacaaatagtacagcaggatgatgttgtcgtcggtaataatagtaac
aaatcaaatgattgtagcagcaaatcagttatattgacatgtgaagatggagcgaagttt
gtaatgccacgcgatgattgtgctatgttgccgatcgtacatgcaaccgtcgaagaattg
gctatatatgtatggagtgagattctaattggacttgattctaaaattttacgtcaaaga
ggaatacataccatggaagttgtcatggcagaagcacctggacaggaggcc

DBGET integrated database retrieval system