Fusarium poae: FPOAC1_006732 Help Entry FPOAC1_006732     CDS       T09519                                  Name (RefSeq) hypothetical protein   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism fpoa  Fusarium poae Pathway fpoa03020   RNA polymerase fpoa03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:fpoa00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     FPOAC1_006732   09124 Replication and repair    03420 Nucleotide excision repair     FPOAC1_006732  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:fpoa03021]     FPOAC1_006732    03400 DNA repair and recombination proteins [BR:fpoa03400]     FPOAC1_006732 Transcription machinery [BR:fpoa03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      FPOAC1_006732   RNA polymerase III system    RNA polymerase III      FPOAC1_006732   RNA polymerase I system    RNA polymerase I      FPOAC1_006732 DNA repair and recombination proteins [BR:fpoa03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       FPOAC1_006732 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  RNA_pol_Rpb8 RNA_pol_RpbG Motif Other DBs NCBI-GeneID:  68341735 NCBI-ProteinID:  XP_044709919 LinkDB All DBs Position 2:complement(7974230..7974751) Genome browser AA seq 148 aa AA seqDB search MASGDATLFEESFTVMEYDQSKYDRVARISCTSADSQTIMSLDINIELFPCARGDSLHVV LTTTLALDGSKEEEKGWRDVGKGGDAPATIADLYDYVCHGKIYKFEETFDGNTINAYVSF GGLLMSLQGPVKKLTPLRVDDVYLLVKK NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atggctagcggagatgccaccctctttgaggagtcctttaccgtaatggagtacgatcag tccaagtacgatcgtgtcgcacgtatttcttgcacatcggccgactcgcagaccatcatg tcgctcgacatcaacattgagttgttcccatgtgcccgtggtgactctttgcatgttgtt ttgacaacaacattggctttggatggcagcaaggaggaagagaagggctggcgggacgtt ggtaagggcggtgatgcgccagccacgattgccgacctctacgactatgtgtgccatggc aagatctacaagtttgaggagacattcgatggaaacaccatcaacgcttacgtctcgttt ggtggtctcctcatgtcgctccagggccctgtcaagaagttgactccgctccgcgtcgac gacgtctaccttcttgtcaagaaataa

DBGET integrated database retrieval system