KEGG   Frankia inefficax: FraEuI1c_2575
Entry
FraEuI1c_2575     CDS       T01354                                 

Name
(GenBank) 2OG-Fe(II) oxygenase
  KO
K21815  2-oxoglutarate dioxygenase / 2-oxoglutarate/L-arginine monooxygenase/decarboxylase [EC:1.13.12.19 1.14.20.7]
Organism
fri  Frankia inefficax
Brite
KEGG Orthology (KO) [BR:fri00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    FraEuI1c_2575
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.12  With incorporation of one atom of oxygen (internal monooxygenases or internal mixed-function oxidases)
    1.13.12.19  2-oxoglutarate dioxygenase (ethene-forming)
     FraEuI1c_2575
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.20  With 2-oxoglutarate as one donor, and the other dehydrogenated
    1.14.20.7  2-oxoglutarate/L-arginine monooxygenase/decarboxylase (succinate-forming)
     FraEuI1c_2575
SSDB
Motif
Pfam: 2OG-FeII_Oxy DIOX_N DUF6247
Other DBs
NCBI-ProteinID: ADP80609
UniProt: E3J3X6
LinkDB
Position
3150203..3151219
AA seq 338 aa
MAGLQTFQLPDSVDGTPLDLQLAQELVRAWRTDGILQVATDPAQSRRTHAALESSRRFFS
QPAAVKASCISDLTFSGYIASGEERTAGEPDYSEIFTVCPDVPLDDPRVRAQWPCHGPVP
WPDDEYERAMTAFMAGLGVIGEKLLRLAALGLGLDLDTLTSLTRDGWHHLRVLRFPARSA
RTSRGIGAHTDYGLLVIAAQDDVGGLYIRPPVDGERRTRNWLPTESMAGRYEDDEPWTFV
EPVPGVVTVFPGDMLQLITDGLLLSTPHKVRLNTRARYALAYFHEPRFQARIRSVSGEND
GDSLHYGSHFTRMFMRSYPERVTTRRILAEDRLSRLVR
NT seq 1017 nt   +upstreamnt  +downstreamnt
atggccggccttcagaccttccaactccccgactcggtggacggcaccccgctcgacctc
cagttggcccaggaactggtccgcgcgtggcggaccgacggaatcctccaggtggcgacc
gacccggcgcagagccgcaggacacacgcggccctggagtcgagcaggcgcttcttcagc
cagcccgccgcggtcaaggccagctgtatcagcgatctgaccttcagcggatacatagcc
tcgggagaagagcgcacggcgggcgagccggactactccgagatcttcaccgtctgccca
gacgtaccgttggacgaccccagggtccgggcgcaatggccctgccatggcccggttccc
tggcccgatgacgagtacgagcgcgccatgacggccttcatggcggggctgggcgtcatc
ggcgagaaactgctgagactggcggcgctgggactgggcctcgacctcgacacattgacg
agcctgacgcgggatggctggcaccacctgcgggtgcttcgctttccggcccggtccgcg
cggacgagccggggaatcggagctcacaccgactacgggctcctcgtgatcgccgcgcag
gacgacgtcggtggcctctacatccgcccgccggtcgacggcgagcggcgcaccaggaac
tggctgccgaccgaaagcatggccggcaggtacgaggacgacgagccctggacgttcgtg
gagccggtgcccggcgtcgtgacggtctttcccggcgacatgctccagctcatcaccgac
ggattgctgctctccaccccgcacaaggtgcggctcaacacccgcgcgcgatatgccctc
gcgtacttccacgagccgcgcttccaggcccgtatccggtcggtttccggggaaaatgac
ggcgattccctgcattacggaagccatttcaccagaatgttcatgcgctcctaccccgag
cgcgtcacgacccggcggatcctcgccgaggaccggttgtcgcgcctcgtccggtag

DBGET integrated database retrieval system