KEGG   Fulvivirga lutea: JR347_11395
Entry
JR347_11395       CDS       T07076                                 
Name
(GenBank) cytochrome P450
  KO
K16593  pimeloyl-[acyl-carrier protein] synthase [EC:1.14.14.46]
Organism
fuv  Fulvivirga lutea
Pathway
fuv00780  Biotin metabolism
fuv01100  Metabolic pathways
fuv01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:fuv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    JR347_11395
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:fuv00199]
    JR347_11395
Enzymes [BR:fuv01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.46  pimeloyl-[acyl-carrier protein] synthase
     JR347_11395
Cytochrome P450 [BR:fuv00199]
 Cytochrome P450, bacteria type
  CYP107 family
   JR347_11395
SSDB
Motif
Pfam: p450
Other DBs
NCBI-ProteinID: QSE96216
LinkDB
Position
complement(2525739..2526923)
AA seq 394 aa
MNLWRPLDTDNINNPYPMYEEIRNAGGIYKAQTGEIIVTNYKSVEAILKDKENFKVGNGK
EWIERGVEYFKTKDTDLTSITDAIDKFILLINPPEHQEIRKFISEVWNEREVENIILANC
NELIDSIKDKSEFDLIEDFASHLPAMTISRIMGIESDSYKELQGHGEKMIKALDFYLKFE
DLLKIEESARAFINYFKKVINKPPASGLISKLTSANSARNKPLSEKQLISICIFLFVAGE
ETTVSFISTSVYNLIRTNQWKTLKGEDVENVIDELLRFDGPVQLLGRIASSDVELNGTTI
SKGSTVTLCLAAANRDPDQFKNPTVLDLTRKPRHLAFGTGNHFCLGDWLARKQAGIALSM
LIKNFPTLHLSNNKFTWRKQLAIRRLELLPVLIK
NT seq 1185 nt   +upstreamnt  +downstreamnt
atgaacctctggaggccgctggatactgacaatattaataatccatacccaatgtatgaa
gagatccgaaatgcaggtggaatctacaaagcgcaaacaggagaaattattgtaacaaat
tacaaatcggtagaggccatattaaaagataaagagaatttcaaagttggtaatggtaaa
gagtggatagaacgtggtgttgaatattttaaaaccaaagacacagacctaacttcaatc
accgatgccatcgataagtttattctcttaataaacccacccgaacatcaggagataagg
aaatttatttctgaagtatggaatgaacgagaggttgaaaatatcattctagctaattgt
aatgagctaattgatagtataaaagacaaaagtgagtttgatttaattgaagactttgct
tctcacttaccagccatgacgatttccagaataatgggaatagaaagcgatagctacaaa
gagctacagggtcatggcgaaaaaatgattaaggcattagatttctacttgaaatttgaa
gacctcttgaaaatagaggaatctgcaagagcgtttattaattacttcaagaaagtaatt
aataaacctcctgcaagcggtcttatttctaagttaacaagtgcaaactcagctagaaac
aaaccattatcagaaaagcagttgatatccatttgcatttttctatttgtagctggtgaa
gaaaccactgtaagctttatctctacctcagtctataaccttattagaactaatcaatgg
aaaacattgaaaggcgaagatgtagaaaatgtcattgatgaacttctgagatttgatggc
cctgtgcagttattgggtagaattgcctcaagtgatgttgagttgaatggaacaacaatt
tcaaagggaagtacagttaccttatgcctggcggcagcaaatcgagatcctgatcaattt
aagaatccaacagttttagatcttacccgcaaacctcgccatctggcctttggcaccggt
aatcacttttgtttaggagattggctcgcaagaaagcaagcaggtattgctctatctatg
cttattaagaatttcccaacactgcatttgagcaacaacaaatttacctggcgaaaacaa
ttagctattcgaaggttagaattactaccggtacttattaaatag

DBGET integrated database retrieval system