Fragaria vesca (woodland strawberry): 101303713 Help Entry 101303713         CDS       T02666                                  Name (RefSeq) beta-glucosidase 11-like   KO K01188   beta-glucosidase [EC:3.2.1.21] Organism fve  Fragaria vesca (woodland strawberry) Pathway fve00460   Cyanoamino acid metabolism fve00500   Starch and sucrose metabolism fve00999   Biosynthesis of various plant secondary metabolites fve01100   Metabolic pathways fve01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:fve00001]  09100 Metabolism   09101 Carbohydrate metabolism    00500 Starch and sucrose metabolism     101303713   09106 Metabolism of other amino acids    00460 Cyanoamino acid metabolism     101303713   09110 Biosynthesis of other secondary metabolites    00999 Biosynthesis of various plant secondary metabolites     101303713 Enzymes [BR:fve01000]  3. Hydrolases   3.2  Glycosylases    3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds     3.2.1.21  beta-glucosidase      101303713 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glyco_hydro_1 Motif Other DBs NCBI-GeneID:  101303713 NCBI-ProteinID:  XP_011464530 LinkDB All DBs Position LG5:10673454..10676897 Genome browser AA seq 101 aa AA seqDB search MVYIKEKYQNPKIYISENGLPMSRKDNSSLSERLKDSDRISYIAKHLYSQSGVNIRGYFY WSLFEWGMGLFESFGLHYDNLKRIPKQSAEWFQRFLQRNDC NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atggtctatatcaaggaaaagtatcaaaacccaaaaatctatatttctgaaaatggactt cctatgtccaggaaggataactcctcgctttctgaacgattgaaggactcggatcgaatc tcctatattgctaaacatttgtatagtcagagtggagtaaacatcagagggtatttctac tggtctttattcgaatggggtatgggattgtttgagtcatttggacttcactatgacaat ttgaaacgtatccccaaacaatctgctgagtggttccaacgtttccttcagagaaatgat tgctaa

DBGET integrated database retrieval system