Grus americana (Whooping crane): 129207498 Help Entry 129207498         CDS       T11359                                  Symbol HRAS Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism game  Grus americana (Whooping crane) Pathway game04010   MAPK signaling pathway game04012   ErbB signaling pathway game04068   FoxO signaling pathway game04137   Mitophagy - animal game04140   Autophagy - animal game04144   Endocytosis game04150   mTOR signaling pathway game04210   Apoptosis game04218   Cellular senescence game04370   VEGF signaling pathway game04371   Apelin signaling pathway game04510   Focal adhesion game04540   Gap junction game04625   C-type lectin receptor signaling pathway game04810   Regulation of actin cytoskeleton game04910   Insulin signaling pathway game04912   GnRH signaling pathway game04916   Melanogenesis game05132   Salmonella infection Brite KEGG Orthology (KO) [BR:game00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     129207498 (HRAS)    04012 ErbB signaling pathway     129207498 (HRAS)    04370 VEGF signaling pathway     129207498 (HRAS)    04371 Apelin signaling pathway     129207498 (HRAS)    04068 FoxO signaling pathway     129207498 (HRAS)    04150 mTOR signaling pathway     129207498 (HRAS)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     129207498 (HRAS)    04140 Autophagy - animal     129207498 (HRAS)    04137 Mitophagy - animal     129207498 (HRAS)   09143 Cell growth and death    04210 Apoptosis     129207498 (HRAS)    04218 Cellular senescence     129207498 (HRAS)   09144 Cellular community - eukaryotes    04510 Focal adhesion     129207498 (HRAS)    04540 Gap junction     129207498 (HRAS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     129207498 (HRAS)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     129207498 (HRAS)   09152 Endocrine system    04910 Insulin signaling pathway     129207498 (HRAS)    04912 GnRH signaling pathway     129207498 (HRAS)    04916 Melanogenesis     129207498 (HRAS)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     129207498 (HRAS)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:game04131]     129207498 (HRAS)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:game04147]     129207498 (HRAS)    04031 GTP-binding proteins [BR:game04031]     129207498 (HRAS) Membrane trafficking [BR:game04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     129207498 (HRAS)  Endocytosis   Macropinocytosis    Ras GTPases     129207498 (HRAS) Exosome [BR:game04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    129207498 (HRAS)   Exosomal proteins of colorectal cancer cells    129207498 (HRAS) GTP-binding proteins [BR:game04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     129207498 (HRAS) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  129207498 NCBI-ProteinID:  XP_054684496 LinkDB All DBs Position 5:20607265..20650239 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVETRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGPG CMNCKCVIS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgactgaatataagctggtggtggtgggagctggtggtgttgggaagagtgctttgaca atacagctcattcagaaccattttgttgatgagtatgaccccacgatagaggattcctac agaaagcaagttgtcatcgacggagagacctgcttgttagacatcttggacactgcaggg caagaggagtacagtgccatgagagaccagtacatgagaacaggggaaggattcctctgc gtcttcgccatcaacaacacaaagtcctttgaagatattcaccagtacagggagcagatc aagagggtgaaagactcagatgatgttcccatggtgctggtgggaaataaatgtgaccta ccagcccggacagtggagacccggcaagcacaggacctggcccggagttatgggatcccc tacatagaaacgtctgccaaaaccagacagggcgttgaagatgccttctacaccttggtg cgggagatccgtcagcacaagctgcgcaagctgaatcccccagatgagagcggccccggc tgcatgaactgtaaatgtgtgatatcgtga

DBGET integrated database retrieval system