Grus americana (Whooping crane): 129214480 Help Entry 129214480         CDS       T11359                                  Symbol CENPX Name (RefSeq) centromere protein X   KO K15360   centromere protein X Organism game  Grus americana (Whooping crane) Pathway game03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:game00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     129214480 (CENPX)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:game03400]     129214480 (CENPX) DNA repair and recombination proteins [BR:game03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      129214480 (CENPX) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  129214480 NCBI-ProteinID:  XP_054702102 LinkDB All DBs Position 18:270157..271868 Genome browser AA seq 80 aa AA seqDB search MEERDGGGFRKETVDRLLRFHFRDGRTRVNGDAQLLMAEMLKVFVREAAARAARQAQAED LEKVDIEHVEKVLPQLLLDF NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atggaggagcgagacggcggcggcttcagaaaggagaccgtggaccggctgctccgcttc cacttccgggacgggaggacccgagttaacggcgacgcgcagctgctgatggcggagatg ctgaaggtcttcgtccgggaagcggcggcgcgagcagcacggcaggctcaggcagaggac ctggagaaagtggatattgagcacgtggagaaggtgctgccacagctgcttctagatttc tag

DBGET integrated database retrieval system