KEGG   Gracilinanus agilis (agile gracile opossum): 123242445
Entry
123242445         CDS       T07702                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein isoform X1
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
gas  Gracilinanus agilis (agile gracile opossum)
Pathway
gas04927  Cortisol synthesis and secretion
gas04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:gas00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    123242445
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    123242445
SSDB
Motif
Pfam: MRAP DIM
Other DBs
NCBI-GeneID: 123242445
NCBI-ProteinID: XP_044526137
LinkDB
Position
3:407714398..407739688
AA seq 173 aa
MANRTNSTHSYYSYEYYMDYVDLPQVDERKLKANKYSIVIAFWVSLAAFVVLLFLILLYM
SWSGTVPIRGACSHRKCPWNYINFIFFIQKSRSHQNSSKSTLQPQGQIKELEDGSSGNEQ
PQGNNCTPDPVLINDGNPPFPENAPHKGLVVQVDSTVEKQAKDPPLPKLKLEK
NT seq 522 nt   +upstreamnt  +downstreamnt
atggcaaataggactaactccacacattcctactatagctatgaatactatatggactac
gtggaccttccgcaagtagatgaaagaaagttgaaggctaacaaatattcaatcgtcatt
gctttttgggtcagccttgcagcatttgtggtgcttctcttcctaattttgctctatatg
tcctggtctggcacagttccaatacggggtgcctgttcacaccgtaaatgcccatggaat
tacatcaacttcatcttcttcatccaaaagtccagaagtcatcaaaatagctccaagagc
accttgcaacctcagggccaaatcaaagaactagaagatggtagttctggcaatgagcaa
ccacagggcaataattgcaccccggatcctgttctaatcaatgatggtaatcctcctttc
ccagaaaatgcacctcataaaggcctggtagtccaagttgatagtacagttgaaaaacaa
gcaaaagacccccctctaccaaaactgaagttagaaaaataa

DBGET integrated database retrieval system