KEGG   Gracilinanus agilis (agile gracile opossum): 123242560
Entry
123242560         CDS       T07702                                 
Name
(RefSeq) calmodulin-alpha-like
  KO
K02183  calmodulin
Organism
gas  Gracilinanus agilis (agile gracile opossum)
Pathway
gas04014  Ras signaling pathway
gas04015  Rap1 signaling pathway
gas04020  Calcium signaling pathway
gas04022  cGMP-PKG signaling pathway
gas04024  cAMP signaling pathway
gas04070  Phosphatidylinositol signaling system
gas04114  Oocyte meiosis
gas04218  Cellular senescence
gas04261  Adrenergic signaling in cardiomyocytes
gas04270  Vascular smooth muscle contraction
gas04371  Apelin signaling pathway
gas04625  C-type lectin receptor signaling pathway
gas04713  Circadian entrainment
gas04720  Long-term potentiation
gas04722  Neurotrophin signaling pathway
gas04728  Dopaminergic synapse
gas04740  Olfactory transduction
gas04744  Phototransduction
gas04750  Inflammatory mediator regulation of TRP channels
gas04910  Insulin signaling pathway
gas04912  GnRH signaling pathway
gas04915  Estrogen signaling pathway
gas04916  Melanogenesis
gas04921  Oxytocin signaling pathway
gas04922  Glucagon signaling pathway
gas04924  Renin secretion
gas04925  Aldosterone synthesis and secretion
gas04970  Salivary secretion
gas04971  Gastric acid secretion
gas05010  Alzheimer disease
gas05012  Parkinson disease
gas05022  Pathways of neurodegeneration - multiple diseases
gas05031  Amphetamine addiction
gas05034  Alcoholism
gas05133  Pertussis
gas05152  Tuberculosis
gas05163  Human cytomegalovirus infection
gas05167  Kaposi sarcoma-associated herpesvirus infection
gas05170  Human immunodeficiency virus 1 infection
gas05200  Pathways in cancer
gas05214  Glioma
gas05417  Lipid and atherosclerosis
gas05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:gas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    123242560
   04015 Rap1 signaling pathway
    123242560
   04371 Apelin signaling pathway
    123242560
   04020 Calcium signaling pathway
    123242560
   04070 Phosphatidylinositol signaling system
    123242560
   04024 cAMP signaling pathway
    123242560
   04022 cGMP-PKG signaling pathway
    123242560
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    123242560
   04218 Cellular senescence
    123242560
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    123242560
  09152 Endocrine system
   04910 Insulin signaling pathway
    123242560
   04922 Glucagon signaling pathway
    123242560
   04912 GnRH signaling pathway
    123242560
   04915 Estrogen signaling pathway
    123242560
   04921 Oxytocin signaling pathway
    123242560
   04916 Melanogenesis
    123242560
   04924 Renin secretion
    123242560
   04925 Aldosterone synthesis and secretion
    123242560
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    123242560
   04270 Vascular smooth muscle contraction
    123242560
  09154 Digestive system
   04970 Salivary secretion
    123242560
   04971 Gastric acid secretion
    123242560
  09156 Nervous system
   04728 Dopaminergic synapse
    123242560
   04720 Long-term potentiation
    123242560
   04722 Neurotrophin signaling pathway
    123242560
  09157 Sensory system
   04744 Phototransduction
    123242560
   04740 Olfactory transduction
    123242560
   04750 Inflammatory mediator regulation of TRP channels
    123242560
  09159 Environmental adaptation
   04713 Circadian entrainment
    123242560
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    123242560
  09162 Cancer: specific types
   05214 Glioma
    123242560
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    123242560
   05163 Human cytomegalovirus infection
    123242560
   05167 Kaposi sarcoma-associated herpesvirus infection
    123242560
  09171 Infectious disease: bacterial
   05133 Pertussis
    123242560
   05152 Tuberculosis
    123242560
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123242560
   05012 Parkinson disease
    123242560
   05022 Pathways of neurodegeneration - multiple diseases
    123242560
  09165 Substance dependence
   05031 Amphetamine addiction
    123242560
   05034 Alcoholism
    123242560
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    123242560
   05418 Fluid shear stress and atherosclerosis
    123242560
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gas01009]
    123242560
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gas04131]
    123242560
   03036 Chromosome and associated proteins [BR:gas03036]
    123242560
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gas04147]
    123242560
Protein phosphatases and associated proteins [BR:gas01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     123242560
Membrane trafficking [BR:gas04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    123242560
Chromosome and associated proteins [BR:gas03036]
 Eukaryotic type
  Centrosome formation proteins
   Centrosome duplication proteins
    Centriole replication proteins
     123242560
Exosome [BR:gas04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   123242560
SSDB
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 EF-hand_FSTL1 EH UPF0154 Caleosin SPARC_Ca_bdg EF_EFCAB10_C EF-hand_STIM1 SAPC2_N MecA_N Dockerin_1
Other DBs
NCBI-GeneID: 123242560
NCBI-ProteinID: XP_044526325
LinkDB
Position
3:473425665..473427187
AA seq 90 aa
MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADG
NGTIDFPEFLTMMARKMKDTDSEEEIREAF
NT seq 273 nt   +upstreamnt  +downstreamnt
atggctgatcagctgactgaggagcagatcgctgaattcaaggaagccttctccctattt
gacaaagatggcgatggcaccatcacgacaaaagaacttggaactgtcatgaggtcattg
ggtcagaatccaacagaagcagaattacaggatatgatcaatgaggtggatgctgatggt
aatggcactattgactttcctgaatttttgaccatgatggctagaaaaatgaaagataca
gacagtgaagaagaaatccgtgaggcattctga

DBGET integrated database retrieval system