KEGG   Gracilinanus agilis (agile gracile opossum): 123245714
Entry
123245714         CDS       T07702                                 
Symbol
MAPK1
Name
(RefSeq) mitogen-activated protein kinase 1 isoform X1
  KO
K04371  mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
gas  Gracilinanus agilis (agile gracile opossum)
Pathway
gas01521  EGFR tyrosine kinase inhibitor resistance
gas01522  Endocrine resistance
gas01524  Platinum drug resistance
gas04010  MAPK signaling pathway
gas04012  ErbB signaling pathway
gas04014  Ras signaling pathway
gas04015  Rap1 signaling pathway
gas04022  cGMP-PKG signaling pathway
gas04024  cAMP signaling pathway
gas04062  Chemokine signaling pathway
gas04066  HIF-1 signaling pathway
gas04068  FoxO signaling pathway
gas04071  Sphingolipid signaling pathway
gas04072  Phospholipase D signaling pathway
gas04114  Oocyte meiosis
gas04140  Autophagy - animal
gas04148  Efferocytosis
gas04150  mTOR signaling pathway
gas04151  PI3K-Akt signaling pathway
gas04210  Apoptosis
gas04218  Cellular senescence
gas04261  Adrenergic signaling in cardiomyocytes
gas04270  Vascular smooth muscle contraction
gas04350  TGF-beta signaling pathway
gas04360  Axon guidance
gas04370  VEGF signaling pathway
gas04371  Apelin signaling pathway
gas04380  Osteoclast differentiation
gas04510  Focal adhesion
gas04517  IgSF CAM signaling
gas04520  Adherens junction
gas04540  Gap junction
gas04550  Signaling pathways regulating pluripotency of stem cells
gas04611  Platelet activation
gas04613  Neutrophil extracellular trap formation
gas04620  Toll-like receptor signaling pathway
gas04621  NOD-like receptor signaling pathway
gas04625  C-type lectin receptor signaling pathway
gas04650  Natural killer cell mediated cytotoxicity
gas04657  IL-17 signaling pathway
gas04658  Th1 and Th2 cell differentiation
gas04659  Th17 cell differentiation
gas04660  T cell receptor signaling pathway
gas04662  B cell receptor signaling pathway
gas04664  Fc epsilon RI signaling pathway
gas04666  Fc gamma R-mediated phagocytosis
gas04668  TNF signaling pathway
gas04713  Circadian entrainment
gas04720  Long-term potentiation
gas04722  Neurotrophin signaling pathway
gas04723  Retrograde endocannabinoid signaling
gas04724  Glutamatergic synapse
gas04725  Cholinergic synapse
gas04726  Serotonergic synapse
gas04730  Long-term depression
gas04810  Regulation of actin cytoskeleton
gas04910  Insulin signaling pathway
gas04912  GnRH signaling pathway
gas04914  Progesterone-mediated oocyte maturation
gas04915  Estrogen signaling pathway
gas04916  Melanogenesis
gas04917  Prolactin signaling pathway
gas04919  Thyroid hormone signaling pathway
gas04921  Oxytocin signaling pathway
gas04926  Relaxin signaling pathway
gas04928  Parathyroid hormone synthesis, secretion and action
gas04929  GnRH secretion
gas04930  Type II diabetes mellitus
gas04933  AGE-RAGE signaling pathway in diabetic complications
gas04934  Cushing syndrome
gas04935  Growth hormone synthesis, secretion and action
gas04960  Aldosterone-regulated sodium reabsorption
gas05010  Alzheimer disease
gas05020  Prion disease
gas05022  Pathways of neurodegeneration - multiple diseases
gas05034  Alcoholism
gas05132  Salmonella infection
gas05133  Pertussis
gas05135  Yersinia infection
gas05140  Leishmaniasis
gas05142  Chagas disease
gas05145  Toxoplasmosis
gas05152  Tuberculosis
gas05160  Hepatitis C
gas05161  Hepatitis B
gas05163  Human cytomegalovirus infection
gas05164  Influenza A
gas05165  Human papillomavirus infection
gas05166  Human T-cell leukemia virus 1 infection
gas05167  Kaposi sarcoma-associated herpesvirus infection
gas05170  Human immunodeficiency virus 1 infection
gas05171  Coronavirus disease - COVID-19
gas05200  Pathways in cancer
gas05203  Viral carcinogenesis
gas05205  Proteoglycans in cancer
gas05206  MicroRNAs in cancer
gas05207  Chemical carcinogenesis - receptor activation
gas05208  Chemical carcinogenesis - reactive oxygen species
gas05210  Colorectal cancer
gas05211  Renal cell carcinoma
gas05212  Pancreatic cancer
gas05213  Endometrial cancer
gas05214  Glioma
gas05215  Prostate cancer
gas05216  Thyroid cancer
gas05218  Melanoma
gas05219  Bladder cancer
gas05220  Chronic myeloid leukemia
gas05221  Acute myeloid leukemia
gas05223  Non-small cell lung cancer
gas05224  Breast cancer
gas05225  Hepatocellular carcinoma
gas05226  Gastric cancer
gas05230  Central carbon metabolism in cancer
gas05231  Choline metabolism in cancer
gas05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
gas05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:gas00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    123245714 (MAPK1)
   04012 ErbB signaling pathway
    123245714 (MAPK1)
   04014 Ras signaling pathway
    123245714 (MAPK1)
   04015 Rap1 signaling pathway
    123245714 (MAPK1)
   04350 TGF-beta signaling pathway
    123245714 (MAPK1)
   04370 VEGF signaling pathway
    123245714 (MAPK1)
   04371 Apelin signaling pathway
    123245714 (MAPK1)
   04668 TNF signaling pathway
    123245714 (MAPK1)
   04066 HIF-1 signaling pathway
    123245714 (MAPK1)
   04068 FoxO signaling pathway
    123245714 (MAPK1)
   04072 Phospholipase D signaling pathway
    123245714 (MAPK1)
   04071 Sphingolipid signaling pathway
    123245714 (MAPK1)
   04024 cAMP signaling pathway
    123245714 (MAPK1)
   04022 cGMP-PKG signaling pathway
    123245714 (MAPK1)
   04151 PI3K-Akt signaling pathway
    123245714 (MAPK1)
   04150 mTOR signaling pathway
    123245714 (MAPK1)
  09133 Signaling molecules and interaction
   04517 IgSF CAM signaling
    123245714 (MAPK1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    123245714 (MAPK1)
   04148 Efferocytosis
    123245714 (MAPK1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    123245714 (MAPK1)
   04210 Apoptosis
    123245714 (MAPK1)
   04218 Cellular senescence
    123245714 (MAPK1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    123245714 (MAPK1)
   04520 Adherens junction
    123245714 (MAPK1)
   04540 Gap junction
    123245714 (MAPK1)
   04550 Signaling pathways regulating pluripotency of stem cells
    123245714 (MAPK1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    123245714 (MAPK1)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    123245714 (MAPK1)
   04613 Neutrophil extracellular trap formation
    123245714 (MAPK1)
   04620 Toll-like receptor signaling pathway
    123245714 (MAPK1)
   04621 NOD-like receptor signaling pathway
    123245714 (MAPK1)
   04625 C-type lectin receptor signaling pathway
    123245714 (MAPK1)
   04650 Natural killer cell mediated cytotoxicity
    123245714 (MAPK1)
   04660 T cell receptor signaling pathway
    123245714 (MAPK1)
   04658 Th1 and Th2 cell differentiation
    123245714 (MAPK1)
   04659 Th17 cell differentiation
    123245714 (MAPK1)
   04657 IL-17 signaling pathway
    123245714 (MAPK1)
   04662 B cell receptor signaling pathway
    123245714 (MAPK1)
   04664 Fc epsilon RI signaling pathway
    123245714 (MAPK1)
   04666 Fc gamma R-mediated phagocytosis
    123245714 (MAPK1)
   04062 Chemokine signaling pathway
    123245714 (MAPK1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    123245714 (MAPK1)
   04929 GnRH secretion
    123245714 (MAPK1)
   04912 GnRH signaling pathway
    123245714 (MAPK1)
   04915 Estrogen signaling pathway
    123245714 (MAPK1)
   04914 Progesterone-mediated oocyte maturation
    123245714 (MAPK1)
   04917 Prolactin signaling pathway
    123245714 (MAPK1)
   04921 Oxytocin signaling pathway
    123245714 (MAPK1)
   04926 Relaxin signaling pathway
    123245714 (MAPK1)
   04935 Growth hormone synthesis, secretion and action
    123245714 (MAPK1)
   04919 Thyroid hormone signaling pathway
    123245714 (MAPK1)
   04928 Parathyroid hormone synthesis, secretion and action
    123245714 (MAPK1)
   04916 Melanogenesis
    123245714 (MAPK1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    123245714 (MAPK1)
   04270 Vascular smooth muscle contraction
    123245714 (MAPK1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    123245714 (MAPK1)
  09156 Nervous system
   04724 Glutamatergic synapse
    123245714 (MAPK1)
   04725 Cholinergic synapse
    123245714 (MAPK1)
   04726 Serotonergic synapse
    123245714 (MAPK1)
   04720 Long-term potentiation
    123245714 (MAPK1)
   04730 Long-term depression
    123245714 (MAPK1)
   04723 Retrograde endocannabinoid signaling
    123245714 (MAPK1)
   04722 Neurotrophin signaling pathway
    123245714 (MAPK1)
  09158 Development and regeneration
   04360 Axon guidance
    123245714 (MAPK1)
   04380 Osteoclast differentiation
    123245714 (MAPK1)
  09159 Environmental adaptation
   04713 Circadian entrainment
    123245714 (MAPK1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    123245714 (MAPK1)
   05206 MicroRNAs in cancer
    123245714 (MAPK1)
   05205 Proteoglycans in cancer
    123245714 (MAPK1)
   05207 Chemical carcinogenesis - receptor activation
    123245714 (MAPK1)
   05208 Chemical carcinogenesis - reactive oxygen species
    123245714 (MAPK1)
   05203 Viral carcinogenesis
    123245714 (MAPK1)
   05230 Central carbon metabolism in cancer
    123245714 (MAPK1)
   05231 Choline metabolism in cancer
    123245714 (MAPK1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    123245714 (MAPK1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    123245714 (MAPK1)
   05212 Pancreatic cancer
    123245714 (MAPK1)
   05225 Hepatocellular carcinoma
    123245714 (MAPK1)
   05226 Gastric cancer
    123245714 (MAPK1)
   05214 Glioma
    123245714 (MAPK1)
   05216 Thyroid cancer
    123245714 (MAPK1)
   05221 Acute myeloid leukemia
    123245714 (MAPK1)
   05220 Chronic myeloid leukemia
    123245714 (MAPK1)
   05218 Melanoma
    123245714 (MAPK1)
   05211 Renal cell carcinoma
    123245714 (MAPK1)
   05219 Bladder cancer
    123245714 (MAPK1)
   05215 Prostate cancer
    123245714 (MAPK1)
   05213 Endometrial cancer
    123245714 (MAPK1)
   05224 Breast cancer
    123245714 (MAPK1)
   05223 Non-small cell lung cancer
    123245714 (MAPK1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    123245714 (MAPK1)
   05170 Human immunodeficiency virus 1 infection
    123245714 (MAPK1)
   05161 Hepatitis B
    123245714 (MAPK1)
   05160 Hepatitis C
    123245714 (MAPK1)
   05171 Coronavirus disease - COVID-19
    123245714 (MAPK1)
   05164 Influenza A
    123245714 (MAPK1)
   05163 Human cytomegalovirus infection
    123245714 (MAPK1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    123245714 (MAPK1)
   05165 Human papillomavirus infection
    123245714 (MAPK1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    123245714 (MAPK1)
   05135 Yersinia infection
    123245714 (MAPK1)
   05133 Pertussis
    123245714 (MAPK1)
   05152 Tuberculosis
    123245714 (MAPK1)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    123245714 (MAPK1)
   05140 Leishmaniasis
    123245714 (MAPK1)
   05142 Chagas disease
    123245714 (MAPK1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    123245714 (MAPK1)
   05020 Prion disease
    123245714 (MAPK1)
   05022 Pathways of neurodegeneration - multiple diseases
    123245714 (MAPK1)
  09165 Substance dependence
   05034 Alcoholism
    123245714 (MAPK1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    123245714 (MAPK1)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    123245714 (MAPK1)
   04933 AGE-RAGE signaling pathway in diabetic complications
    123245714 (MAPK1)
   04934 Cushing syndrome
    123245714 (MAPK1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    123245714 (MAPK1)
   01524 Platinum drug resistance
    123245714 (MAPK1)
   01522 Endocrine resistance
    123245714 (MAPK1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:gas01001]
    123245714 (MAPK1)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gas03036]
    123245714 (MAPK1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gas04147]
    123245714 (MAPK1)
Enzymes [BR:gas01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     123245714 (MAPK1)
Protein kinases [BR:gas01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   123245714 (MAPK1)
Chromosome and associated proteins [BR:gas03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     123245714 (MAPK1)
Exosome [BR:gas04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   123245714 (MAPK1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr ABC1 APH STATB_N Haspin_kinase FTA2 Kinase-like Kdo
Other DBs
NCBI-GeneID: 123245714
NCBI-ProteinID: XP_044530651
LinkDB
Position
1:784006031..784083809
AA seq 359 aa
MAAGGGGAGPEMVRGQVFDVGPRYTNLSYIGEGAYGMVCSAYDNVNKVRVAIKKISPFEH
QTYCQRTLREIKILLRFRHENIIGINDIIRAPAIEQMKDVYIVQDLMETDLYKLLKTQHL
SNDHICYFLYQILRGLKYIHSANVLHRDLKPSNLLLNTTCDLKICDFGLARVADPDHDHT
GFLTEYVATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHIL
GILGSPSQEDLNCIINLKARNYLLSLPHKNKVPWNRLFPNADPKALDLLDKMLTFNPHKR
IEVEQALAHPYLEQYYDPSDEPVAEAPFKFDMELDDLPKEKLKELIFEETARFQPGYRT
NT seq 1080 nt   +upstreamnt  +downstreamnt
atggcggcgggaggcggcggcgcgggtcccgagatggtccgcgggcaggtgttcgacgtg
ggtccgcgctacaccaacctctcgtacatcggcgagggagcctatggcatggtgtgttct
gcgtatgacaacgtcaacaaggtccgtgtggccatcaagaaaatcagcccctttgagcac
cagacctactgccagcggacactgcgcgaaatcaagattttgctacgcttccgccatgag
aacatcattggcatcaacgacatcatccgggcaccagccatcgagcagatgaaagatgta
tacatcgtacaggatctcatggaaacggacctttacaagctcttaaagacgcaacacctc
agcaatgaccacatctgttatttcctttaccagatcctaagaggtttgaaatacatccat
tcagccaacgtcctgcaccgcgacctcaaaccttctaacttactgctcaacaccacctgc
gatctcaagatctgtgactttggcctggcacgtgttgcagatccagaccatgaccacaca
ggcttcctgacagaatatgtggccacacgctggtaccgagcacctgaaatcatgctgaat
tccaagggttacaccaagtccattgacatctggtccgtgggctgtattctggctgagatg
ctctccaacaggcccattttccctggaaagcactaccttgatcagctgaaccacattctt
ggcattcttgggtctccatcacaagaagacttgaattgcataataaatttaaaagccagg
aactatttactctctcttcctcacaaaaacaaggtgccatggaatagactcttccccaat
gctgaccccaaagccctggatttattggataagatgttgacgttcaaccctcacaagagg
atcgaagtggagcaggcactggcccacccctacctggagcagtattacgacccgagtgac
gagcctgtggccgaagccccgttcaagttcgacatggagctggacgacctgcccaaggag
aagctgaaggagctgatctttgaagagacggctcgattccagcccggataccggacttaa

DBGET integrated database retrieval system