KEGG   Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_1342
Entry
GbCGDNIH2_1342    CDS       T03083                                 

Definition
(GenBank) Dihydrofolate reductase
  KO
K17364  dihydromethanopterin reductase [EC:1.5.1.47]
Organism
gbh  Granulibacter bethesdensis CGDNIH2
Pathway
gbh00790  Folate biosynthesis
gbh01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:gbh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    GbCGDNIH2_1342
Enzymes [BR:gbh01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.47  dihydromethanopterin reductase [NAD(P)+]
     GbCGDNIH2_1342
SSDB
Motif
Pfam: DHFR_1
Other DBs
NCBI-ProteinID: AHJ68853
UniProt: W6I2Y4
LinkDB
Position
1541932..1542393
AA seq 153 aa
MPNHNKSLCLSSWPAEIRSMCAIGSGGQLGLNGKLPWQGDQRPAFREDVRRFWERTLGHV
LLCGPATYRSIPATAFTARDILELRSSMQPEDVLSRYPGRIVYIGGGLAVWNTYARFIQH
WDITRLPYDGPADRYFDPAWLATGAGARETSRP
NT seq 462 nt   +upstreamnt  +downstreamnt
gtgccaaaccataacaaatccttatgcctttcttcatggcccgccgagatccgttccatg
tgcgcgatcggttcaggcggacagctcggcctgaacgggaaactgccatggcagggtgac
cagcgtccggccttccgcgaggatgtccgccgtttctgggaacgtacgctcggacatgtc
ctgctatgcggaccagcaacctatcgtagcattccagcgacggcctttaccgcaagggac
atcctcgaactccgctcctccatgcagccagaggacgtgttgagtcgctatcccggccgg
atcgtatatatcggtggcggtttagccgtctggaatacttatgcccgcttcatccagcac
tgggacatcacccgactgccttatgacggacccgctgatcgctatttcgatccggcgtgg
cttgcaaccggcgccggggcaagagaaacttcacgtccttaa

DBGET integrated database retrieval system