Granulibacter bethesdensis CGDNIH4: GbCGDNIH4_1123 Help Entry GbCGDNIH4_1123    CDS       T03156                                  Name (GenBank) sRNA chaperone Hfq   KO K03666   host factor-I protein Organism gbs  Granulibacter bethesdensis CGDNIH4 Pathway gbs02024   Quorum sensing gbs03018   RNA degradation Brite KEGG Orthology (KO) [BR:gbs00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     GbCGDNIH4_1123  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GbCGDNIH4_1123  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:gbs03019]     GbCGDNIH4_1123    03036 Chromosome and associated proteins [BR:gbs03036]     GbCGDNIH4_1123 Messenger RNA biogenesis [BR:gbs03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      GbCGDNIH4_1123 Chromosome and associated proteins [BR:gbs03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     GbCGDNIH4_1123 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  AHJ66479 LinkDB All DBs Position 1247364..1247645 Genome browser AA seq 93 aa AA seqDB search MASEKSQNVQDVFLNHVRKSKTPVTVFLVNGVKLQGIITWFDNFSVLLRRDGHTQLVYKH AISTVMPGAPIQLFDATKPEGGIGHDTAAYSDE NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atggccagtgaaaagtcccagaacgttcaagatgtctttctcaaccatgtgcgcaagagc aagacaccggtgacggtatttctggtcaatggggtcaagcttcagggtattattacctgg tttgacaatttctctgttctcttacgccgtgacgggcatacccagcttgtctataaacat gcaatcagcaccgtgatgccgggtgcacccattcaattgttcgacgcgaccaagccggaa ggcggtattggccatgatacggccgcctattccgacgagtag

DBGET integrated database retrieval system