Candidatus Gullanella endobia: FVIR_GE00466 Help Entry FVIR_GE00466      CDS       T04502                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism ged  Candidatus Gullanella endobia Pathway ged01100   Metabolic pathways ged01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ged00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FVIR_GE00466 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FVIR_GE00466 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N DUF1493 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  CUX96306 UniProt:  A0A143WR82 LinkDB All DBs Position I:826760..826993 Genome browser AA seq 77 aa AA seqDB search MNTIEESVKTIIAEQLGVKKEKVVNNASFVEDLGADSLDTVELVMALEEKFDIEIPDEEA EKITTVQAAIDFIQANQ NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgaacactatcgaagaaagtgttaagacaattatcgctgaacaactgggtgttaagaaa gaaaaagttgttaataatgcttcttttgttgaggacctcggcgctgactctcttgatacc gttgagctggttatggcgctggaagaaaaattcgatatagaaattccggacgaagaagct gaaaaaatcactactgttcaagcagcaattgattttattcaggcaaaccagtaa

DBGET integrated database retrieval system