Glossina fuscipes (tsetse fly): 119645304 Help Entry 119645304         CDS       T09630                                  Name (RefSeq) probable insulin-like peptide 3   KO K04526   insulin Organism gfs  Glossina fuscipes (tsetse fly) Pathway gfs04068   FoxO signaling pathway gfs04081   Hormone signaling gfs04140   Autophagy - animal gfs04150   mTOR signaling pathway gfs04213   Longevity regulating pathway - multiple species Brite KEGG Orthology (KO) [BR:gfs00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     119645304    04150 mTOR signaling pathway     119645304   09133 Signaling molecules and interaction    04081 Hormone signaling     119645304  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     119645304  09150 Organismal Systems   09149 Aging    04213 Longevity regulating pathway - multiple species     119645304  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gfs04052]     119645304 Cytokines and neuropeptides [BR:gfs04052]  Neuropeptides   Unclassified    119645304 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin TANGO6_N Motif Other DBs NCBI-GeneID:  119645304 NCBI-ProteinID:  XP_037901369 UniProt:  A0A9C6E4R2 LinkDB All DBs Position Unknown AA seq 127 aa AA seqDB search MKLNLNLCKFVCCGLLVLVLMTEHSMAGQRFCGKALQDVLDSLCLNGFNPMIRSVMHKKS VDLSDYTDNEIEDSLTAYPYDNSLFLDKLFGEDIGHMMTKTRRRRHGVYDECCRKPCNYT ELASYCL NT seq 384 nt NT seq  +upstreamnt  +downstreamnt atgaaattaaatttgaatttatgtaaattcgtttgctgcggcttactcgtgttggttctg atgactgaacacagtatggccggtcaacgcttttgcggaaaagctttacaagacgtcctg gatagcctatgcctgaatggtttcaatcccatgataagaagtgttatgcataaaaaatcg gttgatttatctgactatacggacaacgaaattgaagattccctaactgcgtatccatac gacaattcgctcttcctagataagctctttggcgaggatatcggccatatgatgaccaaa acacgccgacgtcgtcatggtgtttacgatgaatgttgtcgcaagccttgcaattatact gaactagcatcgtattgcttgtaa

DBGET integrated database retrieval system