KEGG   Gavialis gangeticus (Gharial): 109303426
Entry
109303426         CDS       T07453                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
ggn  Gavialis gangeticus (Gharial)
SSDB
Motif
Pfam: MRAP EVC2_like
Other DBs
NCBI-GeneID: 109303426
NCBI-ProteinID: XP_019381177
LinkDB
Position
Unknown
AA seq 85 aa
MANKTNSSEYYWSYEYYWDYFDPFPVDGRMLKVHKYSIVIAFWVGLAAFLMFLFLILLYM
SRSGSTPVKQVAINNREEENSSRGD
NT seq 258 nt   +upstreamnt  +downstreamnt
atggctaacaaaacaaactcatctgagtattactggtcttatgaatattattgggactat
tttgatccatttccagtagatggaaggatgttgaaggttcataaatattcaattgtcata
gccttttgggttggacttgctgcattcttgatgtttcttttcctcattttgctctacatg
tccagatctggatccacaccagtaaagcaggtggctataaataaccgggaagaagaaaac
agctccagaggtgactga

DBGET integrated database retrieval system