KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101130485
Entry
101130485         CDS       T02442                                 
Symbol
ITGAX
Name
(RefSeq) integrin alpha-X
  KO
K06462  integrin alpha X
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04610  Complement and coagulation cascades
ggo04810  Regulation of actin cytoskeleton
ggo05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101130485 (ITGAX)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    101130485 (ITGAX)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101130485 (ITGAX)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:ggo04515]
    101130485 (ITGAX)
   04090 CD molecules [BR:ggo04090]
    101130485 (ITGAX)
Cell adhesion molecules [BR:ggo04515]
 Integrins
  Integrin alpha subunits
   101130485 (ITGAX)
CD molecules [BR:ggo04090]
 Proteins
  101130485 (ITGAX)
SSDB
Motif
Pfam: VWA Integrin_alpha2 FG-GAP VWA_2 FG-GAP_3 Integrin_alpha VWA_CoxE FG-GAP_2
Other DBs
NCBI-GeneID: 101130485
NCBI-ProteinID: XP_004057604
Ensembl: ENSGGOG00000004075
UniProt: G3RA67
LinkDB
Position
16:27204046..27233664
AA seq 1163 aa
MTRTRAALLLFTALATSLGFNLDTEELTAFRVDSAGFGDSVVQYANSWVVVGAPQKITSA
NQTGGLYQCGYSTGACEPISLQVPPEAVNMSLGLSLASTTSPSQLLACGPTVHHACGRNM
YLTGLCFLLGPTQLTQRLPVSRQECPRQEQDIVFLIDGSGSISSRNFATMMNFVRAVISQ
FQRPSTQFSLMQFSDKFQTHFTFEEFRRSSNPLSLLASVHQLQGFTYTATAIQNVVHQLF
HASYGARRDAAKILIVITDGKKEGDSLDYKDVIPMADAAGIIRYAIGVGLAFQNRNSWKE
LNDIASKPSQEHIFKVEDFDALKDIQNQLKEKIFAIEGTETTSSSSFELEMAQEGFSAVF
TPGGPVLGAVGSFTWSGGAFLYPPNMSPTFINMSQENVDMRDSYLGYSTELALWKGVQSL
VLGAPRYQHTGKAVIFTQVSRQWRMKAEVMGTQIGSYFGASLCSVDVDSDGSTDLVLIGA
PHYYEQTRGGQVSVCPLPRGWRRWWCDAVLYGEQGHPWGRFGAALTVLGDVNGDKLMDVV
IGAPGEEENRGAVYLFHGVLGPSISPSHSQRIAGSQLSSRLQYFGQALSGGQDLTQDGLV
DLAVGARGQVLLLRTRPVLWVGVSMQFIPAEIPRSAFECREQVVSEQTLGQSNICLYIDK
RSKNLLGSRDLQSSVTLDLALDPGRLSPRATFQETKNRSLSRVRVLGLKAHCENFNLLLP
SCVEDSVTPITLRLNFTLVGKPLPAFRNLRPMLAADAQRYFTASLPFEKNCGADHICQDN
LGISFSFPGLKTLLVGSNLELNAEVMVWNDGEDSYGTTITFSHPTGLSYRYVAEGQKQGQ
LRSLHLTCDSAPVGSQGTWSTSCRINHLIFRGGAQITFLATFDVSPKAVLGDRLLLTANV
SSENNTPRTSKTTFQLELPVKYAVYTVVSSHEQFTKYLNFSESEEKESHVAMHRYQVNNL
GQRDLPVSINFWVPVELNQEAVWMDVEVSHPQNPSLRCSSEKIAPPASDFLAHIQKNPVL
DCSIAGCLRFRCDVPSFSVQEELDFTLKGNLSFGWVRQTLQKKVSVASVAEITFDTSVYS
QLPGQEAFMRAQMTTVLEKYKVHNPTPLIVGSSIGGLLLLALITVVLYKVGFFKRQYKEM
MEEANGQIAAENGTQTPSPPSEK
NT seq 3492 nt   +upstreamnt  +downstreamnt
atgaccaggaccagggcagcactcctcctgttcacagccttagcaacttctctaggtttc
aacttggacacagaggagctgacagccttccgtgtggacagtgctgggtttggagacagc
gtggtccagtatgccaactcctgggtggtggttggagccccccaaaagataacatctgcc
aaccaaacgggtggcctctaccagtgcggctacagcactggtgcctgtgagcccatcagc
ctgcaggtgcccccggaggccgtgaacatgtccctgggcctgtccctggcgtctaccacc
agcccttcccagctgctggcctgcggccccaccgtgcaccacgcgtgcgggaggaacatg
tacctcaccggactctgcttcctcctgggccccacccagctcacccagaggctcccggtg
tccaggcaggagtgcccaagacaggagcaggacattgtgttcctgatcgatggctcaggc
agcatctcctcccgcaactttgccacgatgatgaacttcgtgagagctgtgataagccag
ttccagagacccagcacccagttttccctgatgcagttctccgacaaattccaaacacac
tttactttcgaggaattcaggcgcagctcaaaccccctcagcctgttggcttctgttcac
cagctgcaagggtttacatacacggccaccgccatccaaaatgtcgtgcaccaattgttc
catgcctcatatggggcccgtagggatgccgccaaaattctcattgtcatcactgatggg
aagaaagaaggcgacagcctggattataaggatgtcatccccatggctgatgcagcaggc
atcattcgctatgcaattggggttggattagcttttcaaaacagaaattcttggaaagaa
ttaaatgacattgcatcgaagccctcccaggaacacatatttaaagtggaggactttgat
gctctgaaagatattcaaaaccaactgaaggagaagatctttgccattgagggtacggag
accacaagcagtagctccttcgaattggagatggcacaggagggcttcagcgctgtgttc
acacctggtggccccgttctgggggctgtggggagcttcacctggtctggaggtgccttc
ctgtaccccccaaatatgagccctaccttcatcaacatgtctcaggagaatgtggacatg
agggactcttacctgggttactccaccgagctggccctctggaaaggggtgcagagcctg
gtcctgggggccccccgctaccagcacaccgggaaggctgtcatcttcacccaggtgtcc
aggcaatggaggatgaaggctgaagtcatggggactcagatcggctcctacttcggggcc
tccctctgctccgtggacgtggacagcgacggcagcaccgacctggtcctcatcggggcc
ccccattactacgagcagacccgagggggccaggtgtctgtgtgtcccttgcccaggggg
tggagaaggtggtggtgtgatgctgttctctacggggagcagggccacccctggggtcgc
tttggggcggctctgacagtgctgggggatgtgaatggggacaagctgatggacgtggtc
atcggggccccaggagaggaggagaaccggggtgctgtctacctgtttcacggagtcttg
ggacccagcatcagcccctcccacagccagcggatcgcgggctcccagctctcctccagg
ctgcagtattttgggcaggcgctgagcgggggtcaagacctcacccaggatggactggtg
gacctggctgtgggggcccgaggccaggtgctcctgctcaggaccagacctgtgctctgg
gtgggggtgagcatgcagttcatacctgccgagatccccaggtctgcgtttgagtgtcgg
gagcaggtggtctctgagcagaccctgggacagtccaacatctgcctttacattgacaaa
cgttctaagaacctgcttgggagccgtgacctccaaagctctgtgaccttggacctggcc
ctcgaccctggccgcctgagtccccgtgccaccttccaggaaacaaagaaccggagtctg
agccgagtccgagtcctcgggctgaaggcacactgtgaaaacttcaacctgctgctcccg
agctgcgtggaggactctgtgacccccattaccttgcgtctgaacttcacgctggtgggc
aagcccctccctgccttcagaaacctgcggcctatgctggccgccgatgctcagagatac
ttcacggcctccctaccctttgagaagaactgtggagccgaccatatctgccaggacaat
ctcggcatctccttcagcttcccaggcttgaagaccctgctggtggggagtaacctggag
ctgaacgcagaagtgatggtgtggaatgacggggaagactcctacggaaccaccatcacc
ttctcccaccccacaggactgtcctaccgctacgtggcagagggccagaaacaagggcag
ctgcgttccctgcacctgacatgtgacagcgccccagttgggagccagggcacctggagc
accagctgcagaatcaaccacctcatcttccgtggcggcgcccagatcaccttcttggct
acctttgacgtctcccccaaggctgtcctgggagaccggctgcttctgacagccaatgtg
agcagtgagaacaacactcccaggaccagcaagaccaccttccagctggagctcccggtg
aagtacgccgtctacactgtggttagcagccatgaacaattcaccaagtacctcaacttc
tcagagtctgaggagaaggaaagccatgtggccatgcacagataccaggtcaataacctg
ggacagagggacctgcctgtcagcatcaacttctgggtgcctgtggagctgaaccaggag
gctgtgtggatggatgtggaggtctcccacccccagaacccatcccttcggtgctcctca
gagaaaatcgcacccccagcatctgacttcctagcgcacattcagaagaatcccgtgctg
gactgctccattgctggctgcctgcggttccgctgtgacgtcccctccttcagtgtccag
gaggagctggatttcaccctgaagggcaacctcagctttggctgggtccgccagacattg
cagaagaaggtgtcggtcgcgagtgtggctgaaattacgttcgacacatccgtgtactcc
cagcttccaggacaggaggcatttatgagagctcagatgacaacggtgctggagaagtac
aaggtccacaaccccacccccctcatcgtaggcagctccattgggggtctgttgctgctg
gcactcatcacagtggtactgtacaaagttggcttcttcaagcgtcagtacaaggaaatg
atggaggaggcaaatggacaaattgccgcagaaaacgggacacagacccccagcccgccc
agtgagaaatga

DBGET integrated database retrieval system