KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101131486
Entry
101131486         CDS       T02442                                 
Symbol
MRAP
Name
(RefSeq) melanocortin-2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04927  Cortisol synthesis and secretion
ggo04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    101131486 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101131486 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ
Other DBs
NCBI-GeneID: 101131486
NCBI-ProteinID: XP_004062743
UniProt: G3QDG2
LinkDB
Position
21:18393716..18405508
AA seq 172 aa
MANGTNASAPYYSYEYYLDYLDLIPVDEKKLKAHKHSIVIAFWVSLAAFVVLLFLILLYM
SWSSSPQMRNSPKHHQTCPWSHSLNLHLCIQKCLPCHREPLATSQAQASSVEPGSRTGPD
QPLRQESSSTLPLGICQTHPTLLWELTLNGGPLVRSKPSEPPPGDRTSQLQS
NT seq 519 nt   +upstreamnt  +downstreamnt
atggccaacgggaccaacgcctctgccccatactacagctatgaatactacctggactat
ctggacctcattcccgtggacgagaagaagctgaaagcccacaaacattccatcgtgatc
gcattctgggtgagcctggctgcctttgtggtgctcctcttcctcatcttgctctacatg
tcctggtccagctccccgcagatgaggaacagccccaagcaccaccaaacatgcccctgg
agtcacagcctcaacctccacctctgcatccagaagtgcctgccgtgccacagggaaccc
ctggcaacctcacaggctcaggcgagctcagtggagccagggagcagaactggccctgac
cagccgctacgacaggagagctcctccaccttgcccctcgggatttgccagacccacccc
actctcctctgggaattgaccctcaatgggggtcccctcgtcaggagcaagcccagcgag
cctccccctggagacaggacctctcaattgcagagctga

DBGET integrated database retrieval system