KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101136038
Entry
101136038         CDS       T02442                                 
Symbol
TNFRSF8
Name
(RefSeq) tumor necrosis factor receptor superfamily member 8 isoform X1
  KO
K05145  tumor necrosis factor receptor superfamily member 8
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo04060  Cytokine-cytokine receptor interaction
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101136038 (TNFRSF8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:ggo04050]
    101136038 (TNFRSF8)
   04090 CD molecules [BR:ggo04090]
    101136038 (TNFRSF8)
Cytokine receptors [BR:ggo04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   101136038 (TNFRSF8)
CD molecules [BR:ggo04090]
 Proteins
  101136038 (TNFRSF8)
SSDB
Motif
Pfam: TNFR_c6
Other DBs
NCBI-GeneID: 101136038
NCBI-ProteinID: XP_018889005
Ensembl: ENSGGOG00000007758
UniProt: G3QXP0
LinkDB
Position
Unknown
AA seq 595 aa
MRVLLAALGLLFLGALRAFPQDRPFEDTCHGNPSHYYDKAVRRCCYRCPTGLFPTQQCPQ
RPTDCRKQCEPDYYLDEADRCTACVTCSRDDLVEKTPCAWNSSRVCECRPGMFCATSAVN
SCARCFFHSVCPAGMIVKFPGTAQKNTVCEPASPGVSPACASPENCKEPSSGTIPQAKPT
PVSPATSSASTMPVRGGTRLAQEAASKLTRAPDSPSSVGRPSSDPGLSPTQPCPEGSGDC
RKQCEPDYYLDEAGRCTACVSCSRDDLVEKMPCAWNSSRICECRPGMICATSATNSCARC
VPYPICAAETVTKPQDMAEKDTTFEAPPLGTQPDCNPTPEHGEAPASTSPTQSLLVDSQA
SKTLPIPTSAPVALSSTGKPVLDAGPVLFWVILVLAVVVGSSAFLLCHRRACRKRIRQKL
HLCYPVQTSQPKLELVDSRPRRSSTQLRSGASVTEPIAEELGLMSQPLMETCHNVGAAYL
ESLPLQDASPAGGPSSPRDLPEPRVSTEHTNNKIEKIYIMKADTVIVGTVKAELPEGRGL
AGPAEPELEEELEADHTPHYPEQETEPPLGSCSDVMLSVEEEGKEDPLPTAASGK
NT seq 1788 nt   +upstreamnt  +downstreamnt
atgcgcgtcctcctcgccgcgctgggactgctgttcctgggggcgctacgagccttccca
caggatcgacccttcgaggacacctgtcatggaaaccccagccactactatgacaaggct
gtcaggaggtgctgttaccgctgccccacggggctgttcccgacacagcagtgcccacag
aggcctactgactgcaggaagcagtgtgagcctgactactacctggatgaggccgaccgc
tgtacagcctgcgtgacttgttctcgagacgacctcgtggagaagacgccgtgtgcatgg
aactcctcccgtgtctgcgaatgtcgacctggcatgttctgtgccacgtctgccgtgaac
tcctgtgcccgctgcttcttccattctgtctgtccggcagggatgattgtcaagttccca
ggcacggcgcagaagaacacggtctgtgagccggcttccccaggggtcagccctgcctgt
gccagcccagagaactgcaaggaaccctccagtggcaccatcccccaggccaagcccacc
ccggtgtccccagcaacctccagtgccagcaccatgcccgtaagagggggcacacgcctc
gcccaggaagctgcttctaaactgacgagggctcccgactctccctcctctgtgggaagg
cctagttcagatccaggtctgtccccaacacagccatgcccagaggggtctggtgattgc
aggaagcagtgtgagcccgactactacctggacgaggccggccgctgcacggcctgcgtg
agctgttctcgagatgaccttgtggagaagatgccgtgtgcatggaactcctcccgcatc
tgcgaatgtcgacctggcatgatctgtgccacatcagccaccaactcctgtgcccgctgt
gtcccctacccaatctgtgcagcagagacagtcaccaagccccaggatatggctgagaag
gacaccacctttgaggcgccacccctggggacccagccggactgcaaccccaccccagag
catggcgaggcgcctgccagcaccagccccactcagagcttgctggtggactcccaggcc
agtaagacgctgcccatcccaaccagcgctcccgtcgcgctctcctccacggggaagccc
gttctggatgcagggccagtgctcttctgggtgatcctggtgctggctgtggtggtcggc
tccagcgccttcctcctgtgccaccggagggcctgcaggaagcgaattcggcagaagctc
catctgtgctacccggtccagacctcccagcccaagctagagcttgtggattccagaccc
aggaggagctcaacgcagctgaggagtggtgcgtcggtgacagaacccatcgcggaagag
ctagggttaatgagccagccactgatggagacctgccacaacgtgggggcagcctacctg
gagagcctgccgctgcaggatgccagcccggccgggggcccctcgtcccccagggacctt
cctgagccccgggtgtccacggagcacaccaataacaagattgagaaaatctacatcatg
aaggctgacaccgtgatcgtggggaccgtgaaggctgagctgccggagggccggggcctg
gcggggccagcagagcccgagttggaggaggagctggaggcagaccataccccccactac
cccgagcaggagacagaaccacctctgggcagctgcagcgatgtcatgctctcagtggaa
gaggaagggaaagaagaccccttgcccacagccgcctctggaaagtga

DBGET integrated database retrieval system