KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101146228
Entry
101146228         CDS       T02442                                 
Symbol
RAB6D
Name
(RefSeq) LOW QUALITY PROTEIN: ras-related protein Rab-6D
  KO
K07895  Ras-related protein Rab-6C
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ggo04131]
    101146228 (RAB6D)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ggo04031]
    101146228 (RAB6D)
Membrane trafficking [BR:ggo04131]
 Endosome - Golgi transport
  Rab GTPases and associated proteins
   Rab GTPases
    101146228 (RAB6D)
GTP-binding proteins [BR:ggo04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab6/41 [OT]
    101146228 (RAB6D)
SSDB
Motif
Pfam: Ras Roc Arf SRPRB CPT
Other DBs
NCBI-GeneID: 101146228
NCBI-ProteinID: XP_018877477
LinkDB
Position
2B:16599421..16601579
AA seq 254 aa
MSAGGDFGNPLRKFKLVFLGEQSVARTSLITRFMYDSFDNTYQAIIGIDFLSKTMYLEDG
TIGLRLWDTAGQERLRSLIPSYIRDSAAAVVVYDITNVNSFQQTTKWIDDVRTEGGSDVI
IMLVGNRTDLADKRQVSIEEGERKAKGLNVTFIETRAKAGYNVKQLFGRVAAALPGMEST
QDRSREDMSDIKLEKPQEQPVSEGGSSCYPPMSSSTLPQKPPYSFIDCSVNIGLNLFPSL
VTFCNSSLLPVSWR
NT seq 765 nt   +upstreamnt  +downstreamnt
atgtccgcgggcggagacttcgggaatccgctgaggaaattcaagctggtgttcctgggg
gagcaaagcgttgcaaggacatctttgatcaccagattcatgtatgacagttttgacaac
acctatcaggcaataattggcattgactttttatcaaaaactatgtacttggaggatgga
acaatcgggcttcggctgtgggatacggcgggtcaggaacgtctccgtagcctcattccc
agttacatccgtgattctgctgcagctgtagtagtttacgatatcacaaatgttaactca
ttccagcaaactacaaagtggattgatgatgtcagaacagaaggaggaagtgatgttatc
atcatgctagtaggaaatagaacagatcttgctgacaagaggcaagtgtcaattgaggag
ggagagaggaaagccaaagggctgaatgttacgtttattgaaactagggcaaaagctgga
tacaatgtaaagcagctctttggacgtgtagcagcagctttgccgggaatggaaagcaca
caggacagaagcagagaagacatgagtgacataaaactggaaaagcctcaggagcaacca
gtcagcgaagggggttcttcctgctaccctcccatgtcatcttcaacccttcctcagaag
cccccttactctttcattgactgcagtgtgaatattggcttgaaccttttcccttcatta
gtaacgttttgcaattcatcattgctgcctgtctcgtggagatga

DBGET integrated database retrieval system