KEGG   Gorilla gorilla gorilla (western lowland gorilla): 101147010
Entry
101147010         CDS       T02442                                 
Name
(RefSeq) cytochrome P450 3A5 isoform X1
  KO
K17690  cytochrome P450 family 3 subfamily A5 [EC:1.14.14.1]
Organism
ggo  Gorilla gorilla gorilla (western lowland gorilla)
Pathway
ggo00140  Steroid hormone biosynthesis
ggo00830  Retinol metabolism
ggo00980  Metabolism of xenobiotics by cytochrome P450
ggo00982  Drug metabolism - cytochrome P450
ggo01100  Metabolic pathways
ggo05204  Chemical carcinogenesis - DNA adducts
Brite
KEGG Orthology (KO) [BR:ggo00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101147010
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101147010
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101147010
   00982 Drug metabolism - cytochrome P450
    101147010
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    101147010
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ggo00199]
    101147010
Enzymes [BR:ggo01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     101147010
Cytochrome P450 [BR:ggo00199]
 Cytochrome P450, animal type
  CYP3 family
   101147010
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 101147010
NCBI-ProteinID: XP_018886471
Ensembl: ENSGGOG00000003875
UniProt: A0A2I2YBG8
LinkDB
Position
7:72466537..72498490
AA seq 139 aa
MDLIPNLAVETWLLAVSLVLLYLYGTRTHGLFKRLGIPGPTPLPLLGNVLSYRQGLWKFD
TECYKKYGKMWGTYDGQLPVLAITDPDMIRTVLVKECYSVFTNRRICATTSTIKMQTHSV
TTWLPPAVLQSQHGVCLFL
NT seq 420 nt   +upstreamnt  +downstreamnt
atggacctcatcccaaatttggcggtggaaacctggcttctggctgtcagcctggtgctc
ctctatctatatgggacccgtacacatggactttttaagagactgggaattccagggccc
acacctctgcctttgttgggaaatgttttgtcctatcgtcagggtctctggaaatttgac
acagagtgctataaaaagtatggaaaaatgtggggaacgtatgatggtcaactccctgtg
ctggctatcacagatccagacatgataagaacagtgctagtgaaagaatgttattctgtc
ttcacaaatcgaaggatttgtgcaacgaccagcaccatcaagatgcagacccattccgtc
accacgtggctccctcctgctgtcctacagtcacaacatggagtttgtctttttctctga

DBGET integrated database retrieval system