KEGG   Gemmatimonas groenlandica: HKW67_04175
Entry
HKW67_04175       CDS       T07783                                 
Name
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K21585  3-aminobutanoyl-CoA transaminase [EC:2.6.1.111]
Organism
ggr  Gemmatimonas groenlandica
Brite
KEGG Orthology (KO) [BR:ggr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    HKW67_04175
Enzymes [BR:ggr01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.111  3-aminobutanoyl-CoA transaminase
     HKW67_04175
SSDB
Motif
Pfam: Aminotran_3 PD40 Zot
Other DBs
NCBI-ProteinID: QJR34768
UniProt: A0A6M4ILM6
LinkDB
Position
1023179..1024420
AA seq 413 aa
MNRGIPFAGVPDDEWRSRAADVIPGGSSTGSRRPEVLYGSRAFDPAVPTHFERAEGCTLW
SPDGRRFIDCGMALGAVGIGYADPSVTRAVIDAASNGNISALPHRLEVEVAERLVQVIPS
AEQVRFLRTGAEANAAAIRLARALTGREHILACGYFGWLDWCSDAAGVPASVQQDVSWVP
FNDIDALDHAASQLQVPLAAIIIEPLVHDIAHVSWLEAARRLADRTGAVLIFDEVKTAFR
VRTGGVQELTGVTPDLTTLGKAMANGYPLAAVVGRAGVMEVAQRSWISSTAATESTGLAA
AKAVLEWHERIDVPDRMTSAGGMLLQIIGTALAESPWVGVRADGPPMMWRLLADVPDQLD
ALVAVAARHGLLLKRGAYQFGAVAHDEAMLSQVADLMPPIMQALLPGPRRVED
NT seq 1242 nt   +upstreamnt  +downstreamnt
gtgaaccggggcattcccttcgctggcgtgccggacgacgagtggcgttcacgcgctgcc
gacgtgatccctggagggagttcgaccggaagccgccgtccggaggtgctctacggatca
cgagcgttcgacccggcggtccccacgcacttcgaacgcgcggaggggtgcacgctgtgg
tcgcccgacgggcggcgtttcatcgactgcggtatggcgctgggggcggttggcatcggg
tacgccgacccgtccgtcacgcgcgccgtcatcgacgccgcgtccaatggcaacatctcc
gcgctcccgcatcgcctcgaagtcgaagtggccgaacggctcgtgcaggtcattccgtca
gcggagcaggttcgcttcctgcgcaccggcgccgaagcgaatgccgccgccatccggctc
gcacgtgcactgactggtcgcgagcatattctcgcctgtggctacttcggatggctggac
tggtgcagcgacgccgccggcgtgcccgcgtcggtgcagcaagacgtctcgtgggtgccg
ttcaacgacatcgacgccctcgatcacgcggcgtcgcaactccaggtgccactcgcggcg
atcatcatcgagccgctcgtgcatgacatcgcgcacgtgtcctggctcgaagcggctcgg
cgactcgccgatcgcactggggccgtgctcatcttcgacgaggtgaagacggcgtttcgc
gtgcgcaccggcggcgtccaggagctcacgggggtcacacccgatctcacgacgctcggc
aaggcgatggcgaacggctatccattggcggccgtggtcgggcgcgccggcgtgatggag
gtcgcgcaacgcagctggatctcgtcgaccgcggcgactgagagcacgggactcgccgcc
gcgaaggcggtgctggaatggcacgagcgcatcgacgtgcccgatcgcatgacgagcgcc
ggcggcatgctgttgcagatcatcggtacggcgctggccgaatcgccctgggtcggcgtg
cgagccgacggcccgccgatgatgtggcggttgcttgccgacgtgcccgatcagctcgac
gcactcgtggcggtggccgctcgccacggactgctgctcaagcgcggcgcctaccaattc
ggcgcggtcgcgcacgatgaggcgatgctctcgcaggtcgccgacctcatgccgcccatt
atgcaagcgctgctgcccggaccacgacgcgtcgaggactga

DBGET integrated database retrieval system