KEGG   Geobacillus genomosp. 3: M493_00030
Entry
M493_00030        CDS       T02798                                 

Gene name
bphC
Definition
(GenBank) 2,3-dihydroxybiphenyl 1,2-dioxygenase
  KO
K00462  biphenyl-2,3-diol 1,2-dioxygenase [EC:1.13.11.39]
Organism
gjf  Geobacillus genomosp. 3
Pathway
gjf00361  Chlorocyclohexane and chlorobenzene degradation
gjf00621  Dioxin degradation
gjf01100  Metabolic pathways
gjf01120  Microbial metabolism in diverse environments
gjf01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gjf00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00361 Chlorocyclohexane and chlorobenzene degradation
    M493_00030 (bphC)
   00621 Dioxin degradation
    M493_00030 (bphC)
Enzymes [BR:gjf01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.39  biphenyl-2,3-diol 1,2-dioxygenase
     M493_00030 (bphC)
SSDB
Motif
Pfam: Glyoxalase RraB
Other DBs
NCBI-ProteinID: AGT33885
UniProt: S5ZHZ4
LinkDB
Position
pBt40:4668..5615
AA seq 315 aa
MTAEIAKFGHIALITPNLEKSVWFFRDIVGLEEVDRQGDTIFLRAWGDWEHHTLSLTPGN
RARVDHIAWRTKRPEDVETFAEQLKAKGTEVQWIEPGEEKGQGKAIRFRLPNGYPFEIYY
DVEKPKAPEGKKSRLKNNVYRPSYGIAPRRIDHVNVWTTNPSEIHQWLKDNMGFKMREYI
RLNNGFVAGGWMSVTPLVHDIGVMVDPKGQPNRLHHFAYYLDNVTDILRAADILREHDIT
IEMGGPGRHGISQAFFLYVKDPGSGHRLELFSGGYLIFDPDWEPIEWQEHELQEGLIWYG
PEMKPGGPMDDTTEC
NT seq 948 nt   +upstreamnt  +downstreamnt
atgacagctgaaattgcgaaatttggccatatcgctttgataactcctaatcttgaaaaa
tctgtatggttttttagagatatcgttggattggaagaagtagatcgtcagggagacacg
attttcttacgtgcttggggagattgggaacatcacacgctcagtcttacgccggggaac
cgggcacgggtagaccatatcgcctggaggaccaagcgccccgaagatgtggaaacgttt
gctgaacagctaaaggcaaaaggaaccgaagttcaatggattgaaccaggtgaggaaaag
ggacaagggaaagcgataagatttcgtttgccaaacgggtatccctttgagatttattat
gacgtggaaaaaccgaaggcccccgaggggaaaaagtctcgactcaaaaacaatgtgtat
cgcccctcctacgggattgctcctcgccgcattgaccatgtgaatgtatggacaacgaat
ccgtcggagattcatcaatggttaaaagacaacatgggatttaagatgagggagtatatt
cgcttaaacaacggatttgtggcggggggatggatgagcgtcactccgctcgtgcatgat
atcggggtaatggttgatcctaaaggacagcccaacagactgcaccatttcgcatactat
ctggataatgtaaccgatattttgcgtgctgcggatattttgcgggaacacgacatcacg
attgagatgggcggtccggggcgtcatggcattagtcaggcattcttcctgtacgtgaaa
gaccccggaagcgggcacaggctagagttatttagcggagggtacctcatttttgatccc
gattgggagccgattgaatggcaagaacatgaacttcaagaaggactgatttggtacggt
cctgaaatgaaacccggcggtcccatggatgatactactgaatgctaa

DBGET integrated database retrieval system