Trichlorobacter lovleyi: Glov_1647 Help Entry Glov_1647         CDS       T00708                                  Name (GenBank) Chorismate mutase   KO K04093   chorismate mutase [EC:5.4.99.5] Organism glo  Trichlorobacter lovleyi Pathway glo00400   Phenylalanine, tyrosine and tryptophan biosynthesis glo01100   Metabolic pathways glo01110   Biosynthesis of secondary metabolites glo01230   Biosynthesis of amino acids Brite KEGG Orthology (KO) [BR:glo00001]  09100 Metabolism   09105 Amino acid metabolism    00400 Phenylalanine, tyrosine and tryptophan biosynthesis     Glov_1647 Enzymes [BR:glo01000]  5. Isomerases   5.4  Intramolecular transferases    5.4.99  Transferring other groups     5.4.99.5  chorismate mutase      Glov_1647 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CM_2 Motif Other DBs NCBI-ProteinID:  ACD95363 UniProt:  B3EAC5 LinkDB All DBs Position complement(1754161..1754448) Genome browser AA seq 95 aa AA seqDB search MNINETRMRIDLLDDVLLRIFNERARLALEIGHYKKLLDLPVYDPAREKKIFARMKSDNP GPLDDGAIVRLFERVIDESRRLERIMTQQEGQEEC NT seq 288 nt NT seq  +upstreamnt  +downstreamnt gtgaacatcaatgaaaccaggatgcgtatagatttgctggacgatgttttgctcaggatt ttcaatgagcgtgcgcgattggcacttgaaatcggacattacaaaaagctgctggatctg ccggtctatgatccggcgcgtgagaaaaagatttttgcccggatgaagagtgacaatccc ggtccattggacgacggggccatagtacggctttttgagcgggtaattgatgaatcacgg cgtttggaacggatcatgacccagcaggagggacaggaagaatgctga

DBGET integrated database retrieval system