Glarea lozoyensis: GLAREA_03646 Help Entry GLAREA_03646      CDS       T04883                                  Name (RefSeq) TFB5-like protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism glz  Glarea lozoyensis Pathway glz03022   Basal transcription factors glz03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:glz00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     GLAREA_03646   09124 Replication and repair    03420 Nucleotide excision repair     GLAREA_03646  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:glz03021]     GLAREA_03646    03400 DNA repair and recombination proteins [BR:glz03400]     GLAREA_03646 Transcription machinery [BR:glz03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      GLAREA_03646 DNA repair and recombination proteins [BR:glz03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      GLAREA_03646 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 Motif Other DBs NCBI-GeneID:  19462701 NCBI-ProteinID:  XP_008082090 UniProt:  S3D0J1 LinkDB All DBs Position Unknown AA seq 71 aa AA seqDB search MVKAVIGILVQCDPSIKAIIMSIDAADNQFVVEELDDQTLVIKESQLSELKRRLDEQLKD TQQPPEDSGSD NT seq 216 nt NT seq  +upstreamnt  +downstreamnt atggtgaaggcggtcataggaattctcgttcaatgtgacccgtccataaaagctatcatt atgagcatcgacgctgctgataatcaatttgttgtcgaggaacttgatgatcaaacactg gttatcaaggaaagtcagctgtcagagctgaagcgacgactcgatgagcaattgaaggat actcaacagccgcctgaagattcaggatcggattag

DBGET integrated database retrieval system