Gordonia sp. 135: GKZ92_09410 Help Entry GKZ92_09410       CDS       T06305                                  Name (GenBank) 4-oxalocrotonate tautomerase   KO K01821   4-oxalocrotonate tautomerase [EC:5.3.2.6] Organism god  Gordonia sp. 135 Pathway god00362   Benzoate degradation god00621   Dioxin degradation god00622   Xylene degradation god01100   Metabolic pathways god01120   Microbial metabolism in diverse environments god01220   Degradation of aromatic compounds Brite KEGG Orthology (KO) [BR:god00001]  09100 Metabolism   09111 Xenobiotics biodegradation and metabolism    00362 Benzoate degradation     GKZ92_09410    00622 Xylene degradation     GKZ92_09410    00621 Dioxin degradation     GKZ92_09410 Enzymes [BR:god01000]  5. Isomerases   5.3  Intramolecular oxidoreductases    5.3.2  Interconverting keto- and enol-groups     5.3.2.6  2-hydroxymuconate tautomerase      GKZ92_09410 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Tautomerase Tautomerase_2 Tautomerase_3 Motif Other DBs NCBI-ProteinID:  QGP87840 UniProt:  A0A6I5ZDI5 LinkDB All DBs Position 2061488..2061667 Genome browser AA seq 59 aa AA seqDB search MPLIQISQTPGLSDRVKRETIAAVTEAYAKATGKNPDSVWVTITEVPRTQWGVGGEPLG NT seq 180 nt NT seq  +upstreamnt  +downstreamnt atgcccctcatccagatctcgcagacccccggactctccgaccgcgtcaagcgcgagacc atcgcggcggtgaccgaggcgtacgccaaggcgaccggcaagaacccggattcggtctgg gtcacgatcaccgaggtgccgcgcactcagtggggcgtcggcggcgagcccctcggatga

DBGET integrated database retrieval system