Gordonia otitidis: LK459_16975 Help Entry LK459_16975       CDS       T07915                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism goi  Gordonia otitidis Brite KEGG Orthology (KO) [BR:goi00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     LK459_16975 Enzymes [BR:goi01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      LK459_16975 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Glrx-like GST_N_2 Thioredoxin_2 GST_N_3 Thioredoxin ThiN Motif Other DBs NCBI-ProteinID:  UEA61642 LinkDB All DBs Position complement(3727926..3728150) Genome browser AA seq 74 aa AA seqDB search MYTTSWCGYCARLKTALRSSGLEWTEIDIERNPDAAEFVGSVNGGNHVVPTVLYSDGTTA TNPSISDVKKKLGV NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgtacacgacgtcgtggtgcgggtactgcgcccgactcaagacagccctgcgcagctcc ggcctcgagtggaccgagatcgacatcgagcgcaaccccgacgccgccgagttcgtcggc agcgtcaatggcggcaaccacgtcgtcccgacggtgctctactcggacggcacgaccgcc acgaatccgtcgatcagcgacgtgaagaagaagctcggcgtctga

DBGET integrated database retrieval system