KEGG   Gracilibacillus salitolerans: GI584_16970
Entry
GI584_16970       CDS       T06279                                 
Name
(GenBank) BMP family ABC transporter substrate-binding protein
  KO
K05519  transcriptional activator of comK gene
Organism
grc  Gracilibacillus salitolerans
Brite
KEGG Orthology (KO) [BR:grc00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:grc03000]
    GI584_16970
Transcription factors [BR:grc03000]
 Prokaryotic type
  Other transcription factors
   Others
    GI584_16970
SSDB
Motif
Pfam: Bmp Toluene_X LPAM_1 PrpR_N
Other DBs
NCBI-ProteinID: QGH35636
UniProt: A0A5Q2TLL8
LinkDB
Position
complement(3547326..3548291)
AA seq 321 aa
MKKYFILLIIAFIIPILSGCNYHANGEKIERVGMLIEHTIHDQNWGNKGYQGLLDIQEEF
NMDVYFREGVQTQQQVNIAVEEFANQGVQVIIGHSSTYGEFFNRLQASYPDIQFIYVNGG
YSADNLISLNFNSLAMGFFAGMVAGEMTKTNRVGIIAAYEWQPEVEGFYEGVLYQNEDVN
IDIQYVYDWDEKDLAIEHYQKMLDQDTDIIYPAGDAYSVPIIESAMNEGIYSVGYINDQQ
SIGGQSVLTSTIQHIDKLYVYAIEQLEKGNLDGGIYNFGFAEEVITMGPYSEHLPEDFTD
QLNELIADYKETGLLPHQKEK
NT seq 966 nt   +upstreamnt  +downstreamnt
ttgaaaaaatattttatcttgctcattattgcttttataattcccatattatccggatgt
aactaccatgcaaatggtgaaaaaatagagcgtgtaggaatgttaattgaacacaccatt
catgatcaaaactggggcaataagggctatcaaggtttactcgatatacaagaggaattt
aacatggatgtttatttccgtgaaggcgtccagacacaacagcaagtaaatatagccgtt
gaagaatttgccaatcaaggagtgcaggttattattggtcacagcagtacctatggtgaa
ttttttaatcgattacaagcgtcctatcctgatatccaatttatatatgtaaatggtggc
tattcagcggataatttaattagtttaaactttaattctttagcaatggggttttttgct
ggtatggttgcaggtgaaatgacgaaaacaaatcgtgtaggtatcattgcagcctatgaa
tggcagccagaggtagaaggtttttatgagggtgtactttatcaaaatgaagatgtgaac
atagatatacaatatgtctatgattgggatgaaaaagatctggcaatagagcattaccaa
aagatgcttgatcaagatacggatattatttatccagctggcgatgcctatagtgttccg
attattgagtctgctatgaatgaaggtatatattcggttggatatataaatgatcagcaa
tctattggtggacagtctgtattaacgagtacgattcaacatatagataaattatatgtt
tatgcaatagagcaattggaaaaaggtaatttagatggtggaatttataatttcggtttt
gcagaagaagttattacaatgggaccttatagtgaacatttaccagaagactttacggat
caattaaatgaactaattgctgactacaaggaaactggtttattacctcaccaaaaggaa
aaatag

DBGET integrated database retrieval system