KEGG   Bacillus sp. X1(2014): HW35_15245
Entry
HW35_15245        CDS       T03242                                 
Name
(GenBank) transcriptional regulator
  KO
K05519  transcriptional activator of comK gene
Organism
gst  Bacillus sp. X1(2014)
Brite
KEGG Orthology (KO) [BR:gst00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:gst03000]
    HW35_15245
Transcription factors [BR:gst03000]
 Prokaryotic type
  Other transcription factors
   Others
    HW35_15245
SSDB
Motif
Pfam: Bmp Peripla_BP_4 Peripla_BP_6 FlaC_arch
Other DBs
NCBI-ProteinID: AIM17419
UniProt: A0A077J7L6
LinkDB
Position
2933188..2934135
AA seq 315 aa
MLQRFGIILLCLFLLGACGVTKPKGHLTKVGLLVPETINDQVWGTRGFEGLLRIQSKLEV
DVFYKEGMNSEYAVERAVKEFEQKGVNLIFGHGSEYAEYFNHLSSKYPDIHFVSFNGDAK
NPNTTSLNFKSYAMGFFGGMVAAHMSKKNKVGVLAAYEWQPEIEGFYQGALAEKNDIQVS
IEYVEHWDNDMKAMQIADKMMDQGVDVIYPAGDGYNVPVIERVKERGLYVIGYVSDQSDL
GESTVLTSTIQNVGKLYEIVAEQFNKGELKSGNLSFDFQDDVITLGKFSPLVKKDFVQKM
KRYIQTYKETGKLPE
NT seq 948 nt   +upstreamnt  +downstreamnt
atgctgcaacgtttcggaatcattttactatgcctttttttattgggggcgtgtggagtt
acgaaaccgaagggacatttaacaaaagttggtttgttggtccctgagacaatcaatgac
caggtttgggggacaagaggttttgaaggattgttaaggatccaatcaaaattagaagtc
gatgttttttataaagaaggaatgaattctgaatacgcagttgaacgagctgtgaaagaa
tttgagcaaaaaggtgtaaatctgatattcggccatggttcggagtatgcagaatatttt
aatcatctttcctcgaaatatccagatatacactttgtcagttttaatggtgatgctaag
aatcctaatactactagcctcaattttaagtcatatgcaatgggtttttttggcgggatg
gttgctgcccatatgtcaaaaaaaaataaagtgggagttttagccgcctatgaatggcag
cccgaaattgaaggattttatcaaggggcactagctgagaaaaatgacattcaagtaagc
atcgaatatgtggaacattgggataatgatatgaaagcgatgcaaatagcagataaaatg
atggatcagggggtggatgtgatctacccagctggtgatggttataatgtcccagtgatt
gaaagggtaaaggaaagaggattatatgtcattggttatgtttcagaccaatctgattta
ggtgagtctactgttttaacaagtacaattcagaatgttggtaaactatacgagattgtt
gctgaacaatttaataaaggtgaactcaagtctggaaatctttcatttgattttcaagac
gatgtcatcactttgggtaaatttagtcctctagtcaaaaaagactttgttcaaaaaatg
aaaaggtatatacaaacttataaagaaacaggaaaattacctgagtaa

DBGET integrated database retrieval system