Gavia stellata (red-throated loon): 104256001 Help Entry 104256001         CDS       T08384                                  Symbol INS Name (RefSeq) insulin   KO K04526   insulin Organism gste  Gavia stellata (red-throated loon) Pathway gste04010   MAPK signaling pathway gste04068   FoxO signaling pathway gste04081   Hormone signaling gste04114   Oocyte meiosis gste04140   Autophagy - animal gste04150   mTOR signaling pathway gste04810   Regulation of actin cytoskeleton gste04910   Insulin signaling pathway gste04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:gste00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104256001 (INS)    04068 FoxO signaling pathway     104256001 (INS)    04150 mTOR signaling pathway     104256001 (INS)   09133 Signaling molecules and interaction    04081 Hormone signaling     104256001 (INS)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104256001 (INS)   09143 Cell growth and death    04114 Oocyte meiosis     104256001 (INS)   09142 Cell motility    04810 Regulation of actin cytoskeleton     104256001 (INS)  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     104256001 (INS)    04914 Progesterone-mediated oocyte maturation     104256001 (INS)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gste04052]     104256001 (INS) Cytokines and neuropeptides [BR:gste04052]  Neuropeptides   Unclassified    104256001 (INS) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  104256001 NCBI-ProteinID:  XP_009808574 UniProt:  A0A093F406 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MALWIRSLPLLALLALSGPGTSQAAATQHLCGSHLVEALYLVCGERGFFYSPKARRDIEQ PLVSGPLHGEVGELPFQQEEFEKVKRGIVEQCCHNTCSLYQLENYCN NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggctctctggatccgatcgctgcctctactggcccttcttgctctttctggccctggg accagccaagcggctgccacccagcacctctgcggctcccacttggtggaggctctctac ctggtgtgtggagagcggggtttcttctactcccccaaagcccgacgggatattgagcag cctctagtgagcggtcccttgcatggtgaggtaggagagctgcccttccagcaggaagag tttgagaaagtgaagcgagggatcgttgagcaatgctgccacaacacgtgctccctctac caactggaaaactactgcaactag

DBGET integrated database retrieval system