KEGG   Galeopterus variegatus (Sunda flying lemur): 103589329
Entry
103589329         CDS       T08727                                 
Symbol
NRAS
Name
(RefSeq) GTPase NRas
  KO
K07828  GTPase NRas
Organism
gvr  Galeopterus variegatus (Sunda flying lemur)
Pathway
gvr01521  EGFR tyrosine kinase inhibitor resistance
gvr01522  Endocrine resistance
gvr04010  MAPK signaling pathway
gvr04012  ErbB signaling pathway
gvr04014  Ras signaling pathway
gvr04015  Rap1 signaling pathway
gvr04062  Chemokine signaling pathway
gvr04068  FoxO signaling pathway
gvr04071  Sphingolipid signaling pathway
gvr04072  Phospholipase D signaling pathway
gvr04137  Mitophagy - animal
gvr04140  Autophagy - animal
gvr04150  mTOR signaling pathway
gvr04151  PI3K-Akt signaling pathway
gvr04210  Apoptosis
gvr04211  Longevity regulating pathway
gvr04213  Longevity regulating pathway - multiple species
gvr04218  Cellular senescence
gvr04360  Axon guidance
gvr04370  VEGF signaling pathway
gvr04371  Apelin signaling pathway
gvr04540  Gap junction
gvr04550  Signaling pathways regulating pluripotency of stem cells
gvr04625  C-type lectin receptor signaling pathway
gvr04650  Natural killer cell mediated cytotoxicity
gvr04660  T cell receptor signaling pathway
gvr04662  B cell receptor signaling pathway
gvr04664  Fc epsilon RI signaling pathway
gvr04714  Thermogenesis
gvr04720  Long-term potentiation
gvr04722  Neurotrophin signaling pathway
gvr04725  Cholinergic synapse
gvr04726  Serotonergic synapse
gvr04730  Long-term depression
gvr04810  Regulation of actin cytoskeleton
gvr04910  Insulin signaling pathway
gvr04912  GnRH signaling pathway
gvr04915  Estrogen signaling pathway
gvr04916  Melanogenesis
gvr04917  Prolactin signaling pathway
gvr04919  Thyroid hormone signaling pathway
gvr04921  Oxytocin signaling pathway
gvr04926  Relaxin signaling pathway
gvr04929  GnRH secretion
gvr04933  AGE-RAGE signaling pathway in diabetic complications
gvr04935  Growth hormone synthesis, secretion and action
gvr05010  Alzheimer disease
gvr05022  Pathways of neurodegeneration - multiple diseases
gvr05034  Alcoholism
gvr05160  Hepatitis C
gvr05161  Hepatitis B
gvr05163  Human cytomegalovirus infection
gvr05165  Human papillomavirus infection
gvr05166  Human T-cell leukemia virus 1 infection
gvr05167  Kaposi sarcoma-associated herpesvirus infection
gvr05170  Human immunodeficiency virus 1 infection
gvr05200  Pathways in cancer
gvr05203  Viral carcinogenesis
gvr05205  Proteoglycans in cancer
gvr05206  MicroRNAs in cancer
gvr05207  Chemical carcinogenesis - receptor activation
gvr05208  Chemical carcinogenesis - reactive oxygen species
gvr05210  Colorectal cancer
gvr05211  Renal cell carcinoma
gvr05213  Endometrial cancer
gvr05214  Glioma
gvr05215  Prostate cancer
gvr05216  Thyroid cancer
gvr05218  Melanoma
gvr05219  Bladder cancer
gvr05220  Chronic myeloid leukemia
gvr05221  Acute myeloid leukemia
gvr05223  Non-small cell lung cancer
gvr05224  Breast cancer
gvr05225  Hepatocellular carcinoma
gvr05226  Gastric cancer
gvr05230  Central carbon metabolism in cancer
gvr05231  Choline metabolism in cancer
gvr05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
gvr05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:gvr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103589329 (NRAS)
   04012 ErbB signaling pathway
    103589329 (NRAS)
   04014 Ras signaling pathway
    103589329 (NRAS)
   04015 Rap1 signaling pathway
    103589329 (NRAS)
   04370 VEGF signaling pathway
    103589329 (NRAS)
   04371 Apelin signaling pathway
    103589329 (NRAS)
   04068 FoxO signaling pathway
    103589329 (NRAS)
   04072 Phospholipase D signaling pathway
    103589329 (NRAS)
   04071 Sphingolipid signaling pathway
    103589329 (NRAS)
   04151 PI3K-Akt signaling pathway
    103589329 (NRAS)
   04150 mTOR signaling pathway
    103589329 (NRAS)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103589329 (NRAS)
   04137 Mitophagy - animal
    103589329 (NRAS)
  09143 Cell growth and death
   04210 Apoptosis
    103589329 (NRAS)
   04218 Cellular senescence
    103589329 (NRAS)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103589329 (NRAS)
   04550 Signaling pathways regulating pluripotency of stem cells
    103589329 (NRAS)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103589329 (NRAS)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    103589329 (NRAS)
   04650 Natural killer cell mediated cytotoxicity
    103589329 (NRAS)
   04660 T cell receptor signaling pathway
    103589329 (NRAS)
   04662 B cell receptor signaling pathway
    103589329 (NRAS)
   04664 Fc epsilon RI signaling pathway
    103589329 (NRAS)
   04062 Chemokine signaling pathway
    103589329 (NRAS)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103589329 (NRAS)
   04929 GnRH secretion
    103589329 (NRAS)
   04912 GnRH signaling pathway
    103589329 (NRAS)
   04915 Estrogen signaling pathway
    103589329 (NRAS)
   04917 Prolactin signaling pathway
    103589329 (NRAS)
   04921 Oxytocin signaling pathway
    103589329 (NRAS)
   04926 Relaxin signaling pathway
    103589329 (NRAS)
   04935 Growth hormone synthesis, secretion and action
    103589329 (NRAS)
   04919 Thyroid hormone signaling pathway
    103589329 (NRAS)
   04916 Melanogenesis
    103589329 (NRAS)
  09156 Nervous system
   04725 Cholinergic synapse
    103589329 (NRAS)
   04726 Serotonergic synapse
    103589329 (NRAS)
   04720 Long-term potentiation
    103589329 (NRAS)
   04730 Long-term depression
    103589329 (NRAS)
   04722 Neurotrophin signaling pathway
    103589329 (NRAS)
  09158 Development and regeneration
   04360 Axon guidance
    103589329 (NRAS)
  09149 Aging
   04211 Longevity regulating pathway
    103589329 (NRAS)
   04213 Longevity regulating pathway - multiple species
    103589329 (NRAS)
  09159 Environmental adaptation
   04714 Thermogenesis
    103589329 (NRAS)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    103589329 (NRAS)
   05206 MicroRNAs in cancer
    103589329 (NRAS)
   05205 Proteoglycans in cancer
    103589329 (NRAS)
   05207 Chemical carcinogenesis - receptor activation
    103589329 (NRAS)
   05208 Chemical carcinogenesis - reactive oxygen species
    103589329 (NRAS)
   05203 Viral carcinogenesis
    103589329 (NRAS)
   05230 Central carbon metabolism in cancer
    103589329 (NRAS)
   05231 Choline metabolism in cancer
    103589329 (NRAS)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    103589329 (NRAS)
  09162 Cancer: specific types
   05210 Colorectal cancer
    103589329 (NRAS)
   05225 Hepatocellular carcinoma
    103589329 (NRAS)
   05226 Gastric cancer
    103589329 (NRAS)
   05214 Glioma
    103589329 (NRAS)
   05216 Thyroid cancer
    103589329 (NRAS)
   05221 Acute myeloid leukemia
    103589329 (NRAS)
   05220 Chronic myeloid leukemia
    103589329 (NRAS)
   05218 Melanoma
    103589329 (NRAS)
   05211 Renal cell carcinoma
    103589329 (NRAS)
   05219 Bladder cancer
    103589329 (NRAS)
   05215 Prostate cancer
    103589329 (NRAS)
   05213 Endometrial cancer
    103589329 (NRAS)
   05224 Breast cancer
    103589329 (NRAS)
   05223 Non-small cell lung cancer
    103589329 (NRAS)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    103589329 (NRAS)
   05170 Human immunodeficiency virus 1 infection
    103589329 (NRAS)
   05161 Hepatitis B
    103589329 (NRAS)
   05160 Hepatitis C
    103589329 (NRAS)
   05163 Human cytomegalovirus infection
    103589329 (NRAS)
   05167 Kaposi sarcoma-associated herpesvirus infection
    103589329 (NRAS)
   05165 Human papillomavirus infection
    103589329 (NRAS)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    103589329 (NRAS)
   05022 Pathways of neurodegeneration - multiple diseases
    103589329 (NRAS)
  09165 Substance dependence
   05034 Alcoholism
    103589329 (NRAS)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    103589329 (NRAS)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    103589329 (NRAS)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    103589329 (NRAS)
   01522 Endocrine resistance
    103589329 (NRAS)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gvr04131]
    103589329 (NRAS)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gvr04147]
    103589329 (NRAS)
   04031 GTP-binding proteins [BR:gvr04031]
    103589329 (NRAS)
Membrane trafficking [BR:gvr04131]
 Exocytosis
  Small GTPases and associated proteins
   Other small GTPases and associated proteins
    103589329 (NRAS)
 Endocytosis
  Macropinocytosis
   Ras GTPases
    103589329 (NRAS)
Exosome [BR:gvr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103589329 (NRAS)
  Exosomal proteins of other body fluids (saliva and urine)
   103589329 (NRAS)
  Exosomal proteins of breast cancer cells
   103589329 (NRAS)
  Exosomal proteins of colorectal cancer cells
   103589329 (NRAS)
GTP-binding proteins [BR:gvr04031]
 Small (monomeric) G-proteins
  Ras Family
   Ras [OT]
    103589329 (NRAS)
SSDB
Motif
Pfam: Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N Septin Ldh_1_N ParA
Other DBs
NCBI-GeneID: 103589329
NCBI-ProteinID: XP_008569503
UniProt: A0ABM0QMB2
LinkDB
Position
Unknown
AA seq 189 aa
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG
QEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYREQIKRVKDSDDVPMVLVGNKCDL
PTRTVDTKQAHELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRQYRMKKLNSSDDGTQG
CMGLPCAVM
NT seq 570 nt   +upstreamnt  +downstreamnt
atgactgagtacaaactggtggtggttggagcaggtggtgttgggaaaagtgcactgaca
atccagctaatccagaaccactttgtagatgaatatgatccaaccatagaggattcttac
cgaaaacaggtggttatagatggtgaaacctgtctgttggacatactggatacagctgga
caagaggagtacagtgccatgagagaccaatacatgaggacaggcgaaggcttcctctgt
gtatttgccatcaataatagcaaatcatttgcagatattaacctctacagggagcagatt
aaacgagtaaaagactcagatgatgtacctatggtgctggtaggaaacaagtgtgatttg
ccaacaaggacagttgacacaaaacaagcccatgagctggccaagagttatggaattcca
ttcattgaaacctcagccaagaccagacagggtgtcgaagatgccttttacacactggta
agagaaatacgccagtaccgaatgaaaaaactcaacagcagtgatgatgggactcaaggt
tgtatgggattaccatgtgcagtgatgtaa

DBGET integrated database retrieval system