Komagataeibacter medellinensis: GLX_24930 Help Entry GLX_24930         CDS       T01631                                  Name (GenBank) RNA-binding protein   KO K03666   host factor-I protein Organism gxy  Komagataeibacter medellinensis Pathway gxy02024   Quorum sensing gxy03018   RNA degradation Brite KEGG Orthology (KO) [BR:gxy00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     GLX_24930  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     GLX_24930  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:gxy03019]     GLX_24930    03036 Chromosome and associated proteins [BR:gxy03036]     GLX_24930 Messenger RNA biogenesis [BR:gxy03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      GLX_24930 Chromosome and associated proteins [BR:gxy03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     GLX_24930 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq Hfq_1 LSM Motif Other DBs NCBI-ProteinID:  BAK84905 UniProt:  G2I1W9 LinkDB All DBs Position 2756880..2757164 Genome browser AA seq 94 aa AA seqDB search MAKEPSQNVQDVFLNHVRRSKTPVTIFLVNGVKLQGIITWFDNFSVLLRRDGHTQLVYKH AISTVMPASPVSLFEPPAEGGAVEERAPTDGTLS NT seq 285 nt NT seq  +upstreamnt  +downstreamnt gtggcaaaagaaccttcacagaatgtacaggacgtgttcctcaaccacgtccgccggtcc aagacgccggttaccatttttctcgtcaatggggtcaagctccagggtatcatcacctgg tttgacaatttctccgtcctgctgcggcgcgacggacatacgcaactggtctacaagcat gcgatcagcacggtcatgccagcctccccggtcagcctgttcgagccacccgccgagggt ggtgcggtggaggagcgtgcacccacggatggcaccctgtcgtga

DBGET integrated database retrieval system