KEGG   Hahella sp. KA22: ENC22_25955
Entry
ENC22_25955       CDS       T05793                                 
Name
(GenBank) phosphoenolpyruvate synthase
  KO
K21787  prodigiosin/undecylprodigiosin synthetase
Organism
hahe  Hahella sp. KA22
Pathway
hahe00333  Prodigiosin biosynthesis
hahe01100  Metabolic pathways
hahe01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:hahe00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00333 Prodigiosin biosynthesis
    ENC22_25955
SSDB
Motif
Pfam: PPDK_N PEP-utilizers Topoisom_I_N PEP-utilisers_N
Other DBs
NCBI-ProteinID: AZZ94446
UniProt: A0A3T0VT62
LinkDB
Position
5880359..5883082
AA seq 907 aa
MTYDSHIVEVSGQQKSNTQSLGGKASSLNTLAAAGFPVPRAYCLTVDAYASFLQESGLDQ
WISGLEQWDASAFTQIRQRIEDTQLPSSLRQAIVGAYKDIGAERVAVRSSAISEDSEEHS
FAGQYDTYLHVENEENLVDCVKRCWGSFWTERAHAYEGRQDQRRSNDANAPKQGIAVVIQ
AMIDADAAGVLFTADPLNGDPQRTVIESCWGLGEGVVSGQVTTDTFVVDNQKMELLEQTL
REKPVMSTRAENGGVCLRKTATDKINAPTLNENEALALAGYANAIRSHYGREMDIEWALK
DGKIWILQARPITVTPTRGDNRLFADADESNSYIRDNALFSRMDTGEIVTGLMTPLGLSF
CRFYQHKVHGPAVKTMGLLDIGDSQHYMGYLQGHVYLNISASAMLLTQCPPTRDPLKFTK
RYSTEEVDLNFYTNPYGKAPQGLQYLKSAGYWTLYQVRNLMTAERTVRDMISLRKRETER
FLKLDLSAMSLSELNAEMQRIDRYFLESCAAYMPFFLQSFALYDALAELCEKWLGDTSKG
LQNRIKASLSNLRTIEVTRGVCDLAASIQRSNHLRQLVLETPLEQLAQALQNDAEGARFW
NNDFMAFLRDYGARGRQEFELSIPRWADDPSYLLQVIRMYLTSDVQLESRLEEIDRKRDD
DTRALLSGLPLRIRLLFKFVISTYAKMAERREATRPTYIAQTWFYRKIIVEVMRRLSAEK
VLKMEDLPYIDFNELRDYLAGKKSAQQAFSAELIERNRRSHLLNQRLQEPPMAIVGGHTP
QRETAETAPTDDNQVFQGIGASPGVAMGRARVITDLPRQAEEFQQGEILVARFTDASWTP
LFVLAAGVVADVGSMLSHSSIVSREFGIPAIVNTKTTTRRIRTGDMLYLDGDAGIVRIEE
RKEDASQ
NT seq 2724 nt   +upstreamnt  +downstreamnt
atgacttacgattcgcacattgtggaagtctccggacaacaaaagtccaacacgcaaagt
ctgggaggcaaggccagctcgctgaatacgctggcggcggcgggatttcccgtccccagg
gcgtactgcctgaccgtggacgcttacgcctcctttctgcaggagtcaggactggatcaa
tggatcagcggcctggagcaatgggacgccagcgcgtttacgcaaattcgccagcgtatt
gaagatacccaactgccctcttcgttacgtcaggcgatcgtcggcgcatacaaggacatc
ggggccgaacgcgtggcggtgcgctcttccgccatcagcgaagacagcgaggaacactcc
tttgcaggccagtacgacacctacctgcatgtagaaaacgaagaaaacctggtggactgc
gtgaagcgctgctgggggtctttctggacagagcgcgcccacgcttacgaaggccgtcag
gaccaacgccgcagcaacgacgccaacgcccccaaacaaggcatcgccgtggtgattcag
gccatgatcgatgcagacgccgcgggggttctgttcaccgccgatcccctgaacggtgat
ccgcagcgtacggtcatcgagtcctgctggggattgggcgaaggcgtagtttcgggtcag
gtgaccaccgacacttttgttgtcgacaatcagaaaatggaactgctggagcaaaccctg
cgggaaaaaccggtgatgtccacccgcgcagagaacggcggcgtctgcctgcgtaaaacg
gcgacagataaaatcaacgcccctaccctcaacgaaaatgaagccctggccctcgcgggt
tacgccaacgccatccgcagtcactatggacgggagatggatattgagtgggcgctgaag
gacggcaagatctggattctgcaggcccgccccatcaccgtcacgccaacccgcggcgac
aaccgactgtttgcggacgccgatgaaagcaatagctacatacgtgacaacgctctgttc
tcacgtatggataccggtgagatcgtcaccggactgatgacgccattggggctgtcgttc
tgccgcttctaccagcacaaagtacatggccctgcggtcaaaaccatggggttattggat
atcggcgattctcagcactacatgggctacttacagggacatgtgtatctcaatatttcc
gcgtcggcgatgctgttgactcaatgccctccaacccgagacccgttgaaattcaccaag
cgttactctacggaagaagtggacctcaacttctacaccaacccctacggcaaagcgccg
caagggctgcaatatctcaagagcgcgggttactggacattgtatcaagtgcgcaacctg
atgacggcggagcgcaccgtgcgcgacatgatctcattgcgcaaacgagagaccgaacgc
ttcctgaagctggatctcagcgccatgtcgctgagcgagctgaatgcggaaatgcaacgc
atcgaccgttatttcctggaatcctgcgccgcctatatgccgttctttctgcagtcgttc
gcgctatacgacgcgctcgccgagctgtgtgagaagtggctgggcgataccagcaaaggt
ttgcagaatcgcattaaagcgtctctcagcaacctgcgcaccatcgaagtgacccgcggc
gtttgcgatctggcggcctccatccaacgttcaaatcatttgcgacaactggttctggag
acgccgctggagcaattggcgcaggcgctacagaacgacgccgaaggcgctcgcttctgg
aacaatgatttcatggcgtttctgcgcgactacggcgcccgtgggcgtcaagagttcgag
ctcagcatcccgcgctgggctgacgatcccagttatctgttgcaggtgattcgaatgtac
ctgaccagtgacgtgcagttggagtcacggctggaggagatcgatcgtaaacgggatgac
gatacccgcgccctgctgtcaggcctgccattgcgcattcgcctgctgttcaagttcgtc
atctccacctacgccaaaatggcggagcgacgcgaagccacccgccccacttatattgcg
caaacctggttctaccgcaaaatcatcgtcgaagtgatgcgtcgcctcagcgcggagaaa
gtgctgaaaatggaggacttgccttacatcgacttcaacgagctgcgcgattacctggcc
ggaaaaaaatcagcgcaacaggctttctccgcagaactgattgagcgcaaccgccgcagc
cacttgttgaaccagcgtctgcaggaaccgcctatggcgattgtcggcggacataccccc
cagcgcgaaacggcggaaacagcgcccacggatgacaaccaagtgtttcagggcatcggc
gccagtcccggcgtcgccatgggccgcgcccgcgtcattacggatctgccccggcaggcg
gaagagtttcagcaaggcgaaatactggtggcacgcttcaccgacgcctcctggacgccg
ctgttcgtgctcgccgccggcgtcgtcgccgacgtaggatcgatgttatcgcacagttcc
attgtgtcccgggaattcggcatacccgccatcgtcaacactaaaaccaccactcgccgc
atccgcaccggggatatgctctatctcgacggagacgcaggcatcgtgcgcatagaagaa
cgcaaggaggacgccagccagtag

DBGET integrated database retrieval system