KEGG   Hipposideros armiger (great roundleaf bat): 109393511
Entry
109393511         CDS       T04661                                 
Symbol
MRAP
Name
(RefSeq) melanocortin 2 receptor accessory protein
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
hai  Hipposideros armiger (great roundleaf bat)
Pathway
hai04927  Cortisol synthesis and secretion
hai04934  Cushing syndrome
Brite
KEGG Orthology (KO) [BR:hai00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    109393511 (MRAP)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    109393511 (MRAP)
SSDB
Motif
Pfam: MRAP FixQ MRVI1
Other DBs
NCBI-GeneID: 109393511
NCBI-ProteinID: XP_019518360
UniProt: A0A8B7T1G1
LinkDB
Position
Un
AA seq 191 aa
MALTHGQALSLETHRHTWRILRKSVGQLTLRRRPTSSDARPPSAADMANRTNASALYYSY
EYYLDYLDLIPVDEKKLRANKHSIVIAFWVSLAAFVVLLFLILLYMSWSGSLQARNSAQH
HSTCSWSHGLHLPLCVRRHRLRHSTPRATPQAPPSSVKEAGSIASGPHQQLQQESPSTSP
PTTPQAHPALL
NT seq 576 nt   +upstreamnt  +downstreamnt
atggctctcacacatgggcaggccctgagcctggagacccacagacacacttggaggatt
ttacggaaatcagtgggccagctgactctgaggaggaggccgacgagctctgatgcgcgg
ccccccagcgccgcagacatggccaacaggaccaacgcctccgccctgtactacagctat
gagtactacctggattacctggatctcattccggtcgatgagaagaagctgagagccaac
aaacattcgattgtcattgccttctgggtgagcctggctgcttttgtggtgcttctcttc
ctcatcctgctctacatgtcctggtcaggctccctgcaggcgcggaacagcgcccagcac
cactccacatgctcctggagtcacggcctccacctcccgctctgcgtccggaggcaccga
ctgcgtcacagcactcctcgggcaaccccacaggctccaccgagctcagtcaaggaagca
ggcagcatagcatctggcccccaccagcagctgcagcaggagagcccgtccacctcgccc
cccaccactccccaggcccaccctgctctcctctga

DBGET integrated database retrieval system