Hemitrygon akajei (red stingray): 140728757 Help Entry 140728757         CDS       T11019                                  Name (RefSeq) insulin-like   KO K04526   insulin Organism haka  Hemitrygon akajei (red stingray) Pathway haka04010   MAPK signaling pathway haka04068   FoxO signaling pathway haka04081   Hormone signaling haka04114   Oocyte meiosis haka04140   Autophagy - animal haka04150   mTOR signaling pathway haka04810   Regulation of actin cytoskeleton haka04910   Insulin signaling pathway haka04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:haka00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     140728757    04068 FoxO signaling pathway     140728757    04150 mTOR signaling pathway     140728757   09133 Signaling molecules and interaction    04081 Hormone signaling     140728757  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     140728757   09143 Cell growth and death    04114 Oocyte meiosis     140728757   09142 Cell motility    04810 Regulation of actin cytoskeleton     140728757  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     140728757    04914 Progesterone-mediated oocyte maturation     140728757  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:haka04052]     140728757 Cytokines and neuropeptides [BR:haka04052]  Neuropeptides   Unclassified    140728757 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  140728757 NCBI-ProteinID:  XP_072903808 LinkDB All DBs Position 6:complement(130271840..130276073) Genome browser AA seq 113 aa AA seqDB search MVFWSQIVLVSALIIFSCPKGLETLSSQHLCGSHLVETLYFVCGRKGFYYVPKVKRGVEQ FLALQGEESIQENEIEHHVPFNKLLERMKKRGIVESCCHNTCSLFDLEGYCNQ NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atggtgttttggagccaaattgtgctggtgtctgcgttgatcatcttttcttgccctaaa ggactagagacactgtcttcacagcatctgtgtggttctcacctagtagagactctatac tttgtgtgtggacggaagggattttactatgtacctaaagtgaaaagaggagtagagcag tttctagcattacaaggggaagaatcaattcaagaaaatgagatcgaacatcatgttcca ttcaataaactgctggagcggatgaagaagagggggattgtggaaagctgttgtcataat acctgctcactttttgatctggaaggctactgtaaccagtaa

DBGET integrated database retrieval system