KEGG   Haloterrigena alkaliphila: J0X25_19555
Entry
J0X25_19555       CDS       T07793                                 
Name
(GenBank) hypothetical protein
  KO
K16954  methylthiol:coenzyme M methyltransferase [EC:2.1.1.251]
Organism
hakz  Haloterrigena alkaliphila
Pathway
hakz00920  Sulfur metabolism
hakz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hakz00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    J0X25_19555
Enzymes [BR:hakz01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.251  methylated-thiol---coenzyme M methyltransferase
     J0X25_19555
SSDB
Motif
Pfam: URO-D
Other DBs
NCBI-ProteinID: UHQ95057
LinkDB
Position
unnamed1:152685..153653
AA seq 322 aa
MSGRSQSAVEYFRGRQDDPRPWFPLIGRLAASINQVPPEIFLSNATQQTNGIQSAYRLFE
PDAVCTAIDTTLVAEALGAAVEWNESTDSFDVVDPIASPDEVTDPSTVQDRGRLPTVTDV
GERLATNLDEPAVVGVVPGPLTTLEATFGADAALETDRTKPIRTAIGELGRAFGKANVDA
ILVYEDVDRLDEGSGDAADVTVETLEMLDNITGFYNTPLVVAPNGYADATIEAVLERAQP
AGVLLDTDDPAASAERYPDVRVGGGITDELLEAEPDEIRTRVEERCADLPNSGFLASGRE
VPPDIHPTELQAVSDGRPETDG
NT seq 969 nt   +upstreamnt  +downstreamnt
atgagcgggcgcagtcaatcggccgtcgagtacttccgcggtcgccaggacgatccccga
ccctggtttccgctgatcgggcggctcgccgcatcgatcaaccaggtccccccggagata
ttcctctcgaacgccacgcagcagaccaacgggattcagagtgcgtatcgactgttcgag
cccgatgcggtctgtaccgcgatcgatacgacgctcgtcgcggaggcgctgggcgcggcg
gtcgaatggaacgagtcgacggactcgttcgacgtagtcgaccccatcgcgtcacccgac
gaagtgacagatccgtcgacggtacaggaccgcggtcggcttccgacggtgaccgacgtc
ggcgagcggctcgcgaccaacctcgacgagcccgcggtcgtcggcgtcgttcccggtcca
ctgacgaccctggaggcgacgttcggcgcggacgccgctctcgagaccgatcgcactaaa
ccgatccggacggccatcggcgaactcggccgcgcgttcgggaaggcgaacgtcgatgct
atcctcgtctacgaggacgtcgatcggctcgacgagggtagcggggacgctgcggacgtg
accgtcgagacgctggagatgctcgacaatataaccggtttctacaacacgccgctcgtc
gtcgccccgaacggctacgcggacgcgacgatcgaggcggtcctcgagcgcgctcaacct
gcgggcgtgttgctcgataccgacgacccggcagcgagcgccgagcgttacccggacgtt
cgcgtcggcggcggaatcacggatgaactactggaagcggagccggacgagatccggacg
cgggtcgaggaacggtgtgccgacctcccgaactcgggattcctcgccagcggtcgcgaa
gtcccgccggacatccatccgacggagctacaggcagtgagcgacggacggccggagacc
gatggatag

DBGET integrated database retrieval system