KEGG   Haloferax alexandrinus: G3A49_07025
Entry
G3A49_07025       CDS       T06450                                 

Definition
(GenBank) L-arabinose 1-dehydrogenase
  KO
K19660  L-arabinose 1-dehydrogenase [NAD(P)+] [EC:1.1.1.376]
Organism
hale  Haloferax alexandrinus
Pathway
hale00053  Ascorbate and aldarate metabolism
hale01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hale00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00053 Ascorbate and aldarate metabolism
    G3A49_07025
Enzymes [BR:hale01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.376  L-arabinose 1-dehydrogenase [NAD(P)+]
     G3A49_07025
SSDB
Motif
Pfam: Epimerase RmlD_sub_bind 3Beta_HSD GDP_Man_Dehyd NAD_binding_10 NAD_binding_4 Polysacc_synt_2 Sacchrp_dh_NADP NmrA DapB_N TrkA_N
Other DBs
NCBI-ProteinID: QIB77902
UniProt: A0A6C0UQY3
LinkDB
Position
complement(1420802..1421566)
AA seq 254 aa
MARIAVTGAAGNVGRVTVEALASDHDVTPITHREREGLDSVILDVRDEDALTEAFEGHDI
VVHLAANPNPDAAWDSVYEVNIGGTYNVYEAALAADIDRLVFASTNHVHQMYNIADATRP
ETLAADAEAVGVSDPPRPDSYYGVSKVFGEALGNYYADRHGLEVLNLRIGWLLTADEVRE
KMDEEESVARYVRAMWLSPGDCEQGMRRAVEASLPDSPLAVNLISANDDRYLSLTETMRA
IGYRPRDNSATVVE
NT seq 765 nt   +upstreamnt  +downstreamnt
atggcacgtattgcggtcaccggagcggctggtaacgtcgggagagtcacggtcgaagcg
ctggcgtcggaccacgacgtgacgcccatcacgcatcgcgaacgcgagggactcgacagc
gtcatcctcgacgtgcgcgacgaagacgcgctgaccgaggcgttcgagggccacgacatc
gtcgtccacctcgcggccaacccgaaccccgacgcggcgtgggacagcgtctacgaggtc
aacatcggcggcacgtacaacgtctacgaggcggcgctggcggccgatatcgaccgactc
gtcttcgccagcacgaaccacgtccaccagatgtacaacatcgcggacgcgacccgaccg
gagacgctggcggccgacgccgaggcggtcggcgtgtcggacccgccgcgccccgactcg
tactacggcgtgagcaaggtgttcggtgaggcgcttggcaactactacgcggaccgacac
ggactggaagtgctcaatctccgcatcggatggctcctgacggccgacgaggtccgcgag
aagatggacgaagaggagtcggtcgcgcgctacgtccgcgcgatgtggctcagccccggc
gactgcgaacaggggatgcgccgggccgtcgaggcgtcgcttcccgattcgccgctcgcg
gtcaacctcatctcggcgaacgacgaccgatatctctcgctcacggagacgatgcgcgcc
atcggctaccgcccgcgagacaactcggcgaccgtcgtggagtga

DBGET integrated database retrieval system