KEGG   Halorientalis sp. IM1011: BV210_07645
Entry
BV210_07645       CDS       T04693                                 

Name
(GenBank) malate synthase
  KO
K19282  bifunctional (S)-malyl-CoA lyase/thioesterase [EC:4.1.3.24 3.1.2.30]
Organism
hali  Halorientalis sp. IM1011
Pathway
hali00630  Glyoxylate and dicarboxylate metabolism
hali01100  Metabolic pathways
hali01120  Microbial metabolism in diverse environments
hali01200  Carbon metabolism
Module
hali_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:hali00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BV210_07645
Enzymes [BR:hali01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.30  (3S)-malyl-CoA thioesterase
     BV210_07645
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.24  malyl-CoA lyase
     BV210_07645
SSDB
Motif
Pfam: HpcH_HpaI
Other DBs
NCBI-ProteinID: AQL42588
UniProt: A0A1Q1FIF6
LinkDB
Position
1517266..1518579
AA seq 437 aa
MTAIDTRLHDRKFVRTFFTTPTAEKGVDDSAKKLRSAIGLRGMQAPDVWVPDNEDATAPN
MRDEGAENIAEVVAEEGEEFPGEIHPRVVWHRDSPSTRYKGFQHMLEIADPENGAVENID
GFVIPEVGDIDDWKKADEFITIVENEYGLEEGSLAMSVIIESGSAELAMGKLREEMGKAD
NNLERLFLLVDGEVDYTKDMRAITPTGGLPEWKELRHNTSRAASAAGCISVDGPYDDIRD
VDGYHERITANNAMGMLGIWSLTPGQVVEANKSPLPPEEGYWVIDADGREVELDSQDGVE
VYSGDRIELEEEDGGYELEVGSDEIFVESEEELADELLDLVDYVPSMDDIVDSMEEFEAA
KEAGKGAIAMTRAATVEIDGIQVDVSSDRMWDEATYQALMTPVKLFQDVYENRPDQHDDL
ADLYSEDVVERAMDVGN
NT seq 1314 nt   +upstreamnt  +downstreamnt
atgactgcaatcgacacgcgtctccacgaccgaaagttcgtgcggacgttcttcacgaca
ccgacggcggagaagggggtcgacgactcggcgaagaagctccgaagcgccatcggcctg
cgcggcatgcaggccccggacgtgtgggtcccggacaacgaggacgccaccgcgcccaac
atgcgcgatgagggtgccgagaacatcgccgaggtcgtcgccgaggagggcgaggagttc
cccggcgagatccacccccgcgtcgtctggcaccgcgacagccccagcacgcgctacaag
ggcttccagcacatgctcgagatcgccgaccccgagaacggtgccgtcgagaacatcgac
gggttcgtcatcccggaagtcggcgacatcgacgactggaagaaggccgacgagttcatc
acgatcgtcgagaacgagtacggtctcgaagagggcagcctcgccatgtccgtcatcatc
gagtccggctccgccgaactcgcgatgggcaagctccgcgaggagatgggcaaggccgac
aacaacctcgaacgcctgttcctgctggtcgacggtgaggtcgactacaccaaggacatg
cgcgccatcacgccgaccggcggcctccccgagtggaaggaactccgccacaacacctcc
cgcgcggccagcgccgccggctgcatctccgtggacggtccctacgacgacatccgcgac
gtcgacggctaccacgagcgcatcaccgccaacaacgcgatgggcatgctcggcatctgg
tcgctgacgcccggacaggtcgtcgaagccaacaagagcccgctcccgccggaagagggc
tactgggtcatcgacgccgacggtcgcgaagtggaactcgacagccaggacggcgtcgag
gtctacagcggcgaccggatcgaactcgaggaagaggacggcggctacgaactcgaagtc
ggcagcgacgagatcttcgtcgagtccgaggaggaactcgccgacgaactgctcgacctc
gtggactacgtcccgagcatggacgacatcgtcgactccatggaggagttcgaggcggcc
aaggaggccggcaagggcgcgatcgcgatgacccgcgcggccaccgtcgagatcgacggg
atccaggtcgacgtctccagcgaccgcatgtgggacgaagcgacctaccaggcgctgatg
acgccggtcaagctgttccaggacgtctacgagaaccgtccggaccagcacgacgacctc
gcggacctgtacagcgaggacgtcgtcgagcgcgcgatggacgtcggcaactga

DBGET integrated database retrieval system