KEGG   Halocella sp. SP3-1: D7D81_18035
Entry
D7D81_18035       CDS       T05769                                 
Name
(GenBank) aminotransferase class III-fold pyridoxal phosphate-dependent enzyme
  KO
K21585  3-aminobutanoyl-CoA transaminase [EC:2.6.1.111]
Organism
hals  Halocella sp. SP3-1
Brite
KEGG Orthology (KO) [BR:hals00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    D7D81_18035
Enzymes [BR:hals01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.111  3-aminobutanoyl-CoA transaminase
     D7D81_18035
SSDB
Motif
Pfam: Aminotran_3 Aminotran_1_2
Other DBs
NCBI-ProteinID: AZO96340
LinkDB
Position
complement(3748254..3749507)
AA seq 417 aa
MSEVGKLNLEKSMSEVARGYELTPGAVLGIRRPYNFVEGEYPNYFESGKGSRIIDLDGNE
YIDYLCAYGPIIMGYCEEEIDEAVIKQIRDKGFCFSLTQSIQNRLAEKMVEIIPSAEQVI
FLKTGSAAATLAVRLARGYTDKTKIMRCGYHGWHDWCVEVKGGIPEKLYEDVYSFKYNDL
ASLEELLFEHGNDTAAIIITPVGHPLGNKIEEPKPGFLEGVRELADKYNTILIFDEIRTG
FRVALGGAQEYYGVTPDLSLFGKAMANGYAIAAVAGKKEVMKKAEHDVFVSSTFFPNSLS
FAAALKTIELLQSKKVLEYIWEKGSKFLEDIKALTEKHQVGAEVSGIPPMPYITFQRDKA
KTYKAKRTDFYTQLIRRRVFMQPYHHGYICYRHTDEDLNYTVKAIEESLIYIEEKDY
NT seq 1254 nt   +upstreamnt  +downstreamnt
atgagtgaagtaggaaaattaaatttagaaaaaagcatgagtgaggtagccaggggttat
gagctgacacctggtgctgtgcttgggatcaggagaccttataattttgtagagggtgaa
tacccaaattactttgaatctggtaaagggtccaggattattgacctggatggtaatgaa
tatattgattatctatgtgcttatggtccaattattatgggctactgtgaggaagaaata
gatgaggctgttataaaacagattagagataagggtttctgtttttctttaactcaatct
attcaaaataggttggcagaaaaaatggttgaaataataccatctgctgaacaggttatc
tttctaaagacaggttctgctgctgccaccctggctgttagactggcccgaggttatacc
gataagaccaagattatgcgctgtggttatcacggctggcatgactggtgtgttgaggta
aagggtggtataccagaaaaactctatgaagatgtttacagttttaaatataatgacctt
gctagtctggaagagttattgttcgagcatggtaatgatactgctgctatcatcataaca
ccggttggccatccactgggtaataagattgaagaaccaaaacctggtttcttagaaggt
gttagagaactggctgataagtataatactatcctgatctttgatgagattaggactggt
ttccgggtagcactgggtggtgcccaggaatattatggagtgacaccagatctatcactc
tttggtaaggcgatggcaaatggctatgctattgctgcagtagccggcaaaaaagaggta
atgaaaaaggcagaacatgatgtgtttgtttcttccacgttttttcccaacagtctttct
tttgccgcggctttaaagactattgagttattacagtccaaaaaggtactggaatatatc
tgggaaaagggtagtaagttcttagaagatattaaagcgctgactgagaaacaccaggta
ggggcagaggtatctggtatacctcctatgccttatataaccttccagagggataaagct
aaaacctataaagcaaagagaactgatttctatacacagttgatcaggcgtcgtgtcttt
atgcagccctatcaccacggctatatctgctatcgtcatactgatgaagaccttaattat
acagttaaggctattgaagagagcttgatctatattgaagaaaaagattattaa

DBGET integrated database retrieval system